Details for Capsella Locus Carubv10013186m

Position : scaf_3 ( 5`- 6966757 .. 6970805 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013186m

Protein [Map View]
MVAAVPLAAISTTDPYKNPPRDRQDKPQLSSNNGGLQRRPRPAKNVPSRYLSPSPSRPHSHSTPTTTSSSSSSSAVAVLR
SSKRYPSPLLSRTTNSASDFVKTPSSLLKRSQSADRRPPSAVSDTGTEMSAATKMHITSTRSLSVSFQGEAFSLPISKKK
ETTAPVSHRKSTPDRRRCTPVRDQRENSKPVDQQLWPGASRRGISEPVVPNSLSTSVDCDSDDGRKLGSGFAGRSTLQHS
QSSRVSVDGRLDLRRGDDILEMRDESKTRPSTHPQLGSSVSCDFTASDTDSVSSGSTNGAQECGSGVHGEVSKTRSLSRN
AMGSAKFWQETNSRLRRLQDPGSPRCSSPSSRISSISSKFSQSKRFSSDSPLASSPRGMSSPVRGATRPASPSKLWATTT
SSSARAPSPSRARNGVSEQMNAYNRTLPSILCFSADIRRGKIGEDRVMDAHLLRLLYNRYLQWRFANARADSTFMVHRLS
AEKNLWNAWVSISELRHSVTLKRIKLLLLRQKLKLAFILKEQVGYLEEWSLLDRDHSNSLLGATESLKASTLRLPISGKA
LVDIQDLKHAVSSAVDVMHAMVSSLFSLTLKVEDMNSVMAEMVNVTAKEKVLVEQCQGLLSKVAAMQVTDCSMKTHIIQL
SRI*

DNA
ATGGTGGCTGCGGTTCCTCTAGCAGCAATCTCCACCACCGACCCTTATAAGAATCCACCTCGAGATCGCCAAGATAAACC
TCAACTCTCTTCTAACAATGGCGGACTACAACGAAGACCTAGACCTGCTAAAAATGTCCCCTCTCGCTACTTATCCCCTT
CTCCTTCTCGTCCTCATTCTCATTCCACACCCACTACTACATCTTCTTCTTCTTCTTCTTCTGCGGTTGCGGTACTGAGG
TCGAGTAAGCGATATCCTTCCCCTTTACTCTCTCGCACCACGAATTCTGCTTCTGATTTCGTTAAGACGCCTTCCTCGTT
GCTCAAACGGTCGCAATCGGCTGACCGTCGTCCGCCGTCGGCAGTTTCTGACACTGGCACTGAAATGTCGGCGGCCACGA
AGATGCATATCACCTCCACTAGGAGTTTATCTGTTTCTTTTCAAGGAGAGGCGTTTTCGCTTCCGATTAGTAAGAAGAAG
GAGACTACCGCGCCGGTTTCTCACCGGAAATCTACTCCGGACCGGCGGAGGTGTACACCTGTTCGAGATCAGAGGGAGAA
TTCGAAGCCGGTTGATCAGCAGCTGTGGCCAGGCGCTTCTCGGAGGGGAATTTCAGAACCTGTTGTCCCGAATTCACTTT
CTACAAGTGTGGATTGTGACAGTGATGATGGGAGGAAGCTTGGATCTGGCTTTGCGGGAAGGTCGACGTTGCAGCATTCT
CAGAGTTCTAGGGTTTCTGTTGATGGAAGATTAGATTTGAGAAGAGGTGATGATATTTTGGAAATGAGAGATGAGAGCAA
GACAAGACCAAGCACACATCCGCAATTGGGTTCTAGTGTCTCGTGTGACTTTACTGCATCTGATACTGATAGTGTTTCAT
CTGGTAGCACTAATGGTGCGCAGGAATGTGGTTCTGGTGTCCATGGTGAGGTTTCTAAAACAAGGAGCTTGTCCCGTAAT
GCTATGGGTTCTGCTAAATTCTGGCAAGAGACTAATAGCCGGTTAAGGCGGTTGCAGGATCCTGGCTCACCTCGATGCTC
TAGCCCAAGTTCGAGAATCAGTAGTATCTCATCGAAGTTCAGTCAATCGAAACGGTTCTCTAGTGATAGTCCGTTGGCAT
CATCACCTCGTGGTATGTCTTCTCCAGTAAGGGGTGCCACTCGCCCTGCTTCACCAAGTAAGCTTTGGGCAACAACTACA
TCATCTTCAGCTAGGGCACCTAGTCCTTCTCGCGCGAGAAATGGAGTTTCCGAACAAATGAATGCTTATAACCGCACCTT
GCCTTCAATTCTTTGTTTCTCTGCTGATATTAGGAGGGGGAAAATTGGGGAAGATCGCGTTATGGATGCCCACTTGTTGA
GGCTTCTGTACAACCGTTATCTACAATGGCGGTTTGCCAATGCTAGGGCAGACTCCACTTTCATGGTACATAGACTGAGT
GCAGAGAAAAACCTATGGAATGCATGGGTATCAATTTCGGAACTGCGCCATTCTGTCACTCTGAAACGGATCAAGTTGCT
CTTGCTGAGGCAGAAACTGAAACTAGCTTTCATCTTGAAGGAGCAGGTTGGTTATCTAGAAGAATGGTCTCTTCTGGATA
GAGATCATTCGAATTCTTTGTTAGGAGCAACTGAATCCCTGAAAGCGAGCACGCTTCGTCTTCCAATTAGTGGAAAAGCC
TTGGTTGATATCCAAGATCTCAAGCATGCTGTTAGTTCAGCAGTTGATGTCATGCACGCTATGGTGTCTTCTTTATTTTC
GCTGACACTAAAGGTAGAGGACATGAACTCGGTAATGGCAGAAATGGTGAATGTCACTGCAAAAGAAAAGGTTTTGGTTG
AACAGTGTCAAGGATTATTATCAAAAGTAGCAGCAATGCAGGTTACGGACTGCAGCATGAAGACGCACATAATACAACTA
AGCCGGATATAA