Details for Capsella Locus Carubv10013185m

Position : scaf_3 ( 5`- 6644769 .. 6648330 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013185m

Protein [Map View]
MEGTCFLRGQPLVTTIHSLPRKGFHLQGWKTNRIVRLSALKNHSGLGKARSLDLSLRASASGPIRASSAVTEAIPSNSNA
KEEDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTNEGTQPVEKLEIVECDLEKKDSIKP
ALGNASVIICCIGASEKEISDITGPYRIDYLATKNLVDAAKSAKVNNFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAE
EALIASGLNYAIVRPGGMERPTDAYKETHNLTLSLDDTLFGGQVSNLQVAELLACMAKNPQLSCSKIVEVVAETTAPLTP
MEKLLEKIPSKRPYVPPPKGSIAAKEVKPVPTKPVTQEPTAPKEDEAPQKEKYVKPRPLSPYAAYEDLKPPTSPIPSSTA
SLSPAKSKEVDATEVPVEANIVPDSISNVPVEEEEELKQAGEEEVKKPEEKKGRPLSPYASYENLKPPSSPYPKASGTRK
TDSLSPGPTDSDTDKSSTVATSVTETAVATSAPETAVATNVTETAAPATPRMRPLSPYAVYADLKPPTSPTPASTGPKKA
ASAEDNSELPGGNNDVPKTVDGSVNTTPSPSIPEAVPVVTNVETSLAAGDNPAQPKPRPLSPYTMYEDMKPPTSPIPSPV
INH*

DNA
ATGGAAGGAACTTGTTTTCTCCGTGGGCAACCTCTCGTCACAACTATACATTCTCTTCCAAGGAAAGGGTTTCATCTCCA
AGGATGGAAGACCAATCGGATTGTCAGATTATCAGCTTTAAAGAATCACTCCGGTCTCGGAAAGGCCAGGTCTTTAGATC
TTAGCCTCAGGGCTTCTGCTTCAGGTCCCATAAGAGCAAGCTCTGCAGTAACAGAAGCAATCCCTTCCAACTCAAATGCC
AAAGAAGAAGACCTTGTCTTTGTAGCTGGTGCTACTGGTAAAGTTGGTTCTAGAACTGTGAGAGAACTACTGAAGCTGGG
ATTTCGGGTTAGAGCTGGAGTTCGAAGTGCTCAGAGAGCAGGAAGTCTTGTGCAAAGTGTTAAGGAAATGAAGCTCCAGA
ACACTAATGAAGGAACTCAACCTGTAGAAAAGCTTGAAATTGTGGAATGTGACTTGGAGAAGAAAGATTCTATAAAGCCT
GCATTGGGAAATGCATCGGTGATTATATGCTGTATCGGTGCTAGCGAGAAAGAGATCTCCGATATAACTGGCCCTTACAG
GATCGATTACCTAGCCACCAAAAACCTTGTTGATGCTGCAAAATCTGCAAAAGTTAATAACTTCATTTTGGTGACATCCT
TGGGGACAAATAAATTTGGATTTCCCGCTGCTATTCTCAACCTATTCTGGGGAGTTCTTTGCTGGAAGAGAAAAGCTGAA
GAAGCATTGATTGCAAGCGGCCTCAATTACGCAATAGTTAGGCCTGGAGGAATGGAGAGGCCCACCGATGCATACAAAGA
AACTCATAATCTCACTCTTTCTCTAGACGATACATTGTTCGGTGGTCAGGTCTCAAACCTCCAGGTTGCAGAATTGCTCG
CTTGTATGGCAAAGAATCCTCAACTTTCTTGCTCCAAGATTGTGGAAGTGGTTGCTGAAACAACTGCTCCATTAACTCCA
ATGGAAAAGCTTCTTGAAAAGATTCCTTCCAAACGTCCTTATGTGCCTCCACCAAAGGGATCAATTGCAGCCAAAGAGGT
CAAACCAGTCCCTACTAAGCCTGTCACTCAAGAGCCAACAGCTCCCAAGGAGGATGAAGCACCTCAAAAAGAAAAATATG
TGAAACCTAGGCCGCTGTCTCCTTATGCGGCCTACGAAGACTTGAAACCTCCAACATCTCCTATTCCAAGTTCGACCGCA
TCACTCAGTCCTGCCAAATCTAAGGAGGTAGATGCCACTGAGGTTCCTGTTGAGGCCAATATAGTGCCGGATAGTATCTC
AAACGTCCCAGTAGAAGAAGAAGAAGAATTAAAGCAAGCTGGAGAAGAAGAAGTGAAGAAACCTGAGGAAAAGAAAGGGA
GGCCTCTTTCCCCTTATGCCAGCTATGAAAATCTGAAACCACCTTCATCACCCTATCCTAAAGCTTCGGGAACCAGAAAG
ACTGATTCTTTGTCGCCTGGTCCAACTGATTCTGATACTGATAAAAGCTCAACAGTTGCAACAAGCGTCACTGAGACAGC
AGTTGCAACAAGTGCCCCTGAGACAGCAGTTGCAACAAATGTTACTGAGACAGCAGCACCAGCCACACCAAGAATGAGGC
CTCTTTCTCCTTATGCAGTGTACGCTGACCTGAAACCACCAACCTCACCAACTCCTGCATCAACTGGTCCCAAGAAAGCA
GCATCTGCAGAAGACAACTCAGAGTTGCCTGGAGGCAATAATGATGTGCCGAAAACAGTTGATGGAAGTGTGAACACTAC
TCCATCTCCTTCCATACCTGAAGCAGTACCTGTTGTTACCAATGTAGAGACTTCCCTTGCTGCCGGAGACAATCCAGCTC
AGCCAAAGCCAAGACCTTTATCACCTTACACAATGTACGAGGACATGAAGCCTCCAACATCACCAATTCCATCTCCAGTC
ATCAATCATTAG