Details for Capsella Locus Carubv10013183m

Position : scaf_3 ( 5`- 3693360 .. 3696260 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013183m

Protein [Map View]
MPSRRSDSAIKLIAYSEELVDGKPFYAFSNCLPVKALNREPAGHAFHSAALKLHGCAEEPTDNEDSDKKVGDDKEKEYVP
SFNSYANKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRKSYREAALKHHPDKLATLLLAEETEEAKEAKKDEIESRFKA
IQEAYEVLMDPTRRRIFDSTDEFDDEVPSDCLPQDFFKVFGPAFKRNARWSVNQRIPDLGDEDTPLKDVDKFYNFWYAFK
SWREFPDEEEHDLEQADSREERRWMEKENAKKTVKARKEEHARIRTLVDNAYRKDPRIVKRKEEEKAEKQQKKEAKLLAK
KKQAEDAAIAAEEEKRRKEEEEKRAAESAQQQKKNKEKEKKLLRKERNRLRTLSAPLVAQHLLDISEEDIENLCMSLNTE
QLQNLCDKMGNKEGLELAKVIKDGCESSRNDEAETKEKESKKTNGGTEPKTRVSQLDSSTQKKQPWSKEEIDMLRKGMIK
YPKGTSRRWEVVSEYIGTGRSVEEILKATKTVLLQKPDSAKAFDSFLEKRKPSASISSPLSTREELGESLPTMTTTKASP
SKETVVGKSSSSQVSDTNGEAGGSSDADGWSTVQERALVQALKTFPKETSQRWERVAAAVPGKTMIQCKKKFAELKEIIR
NKKTGV*

DNA
ATGCCGAGCCGGAGAAGTGACTCTGCCATTAAGCTAATTGCTTACTCTGAGGAACTTGTGGATGGAAAACCGTTCTATGC
ATTTTCCAATTGTCTTCCTGTGAAGGCTTTAAACCGTGAACCTGCTGGTCATGCCTTCCATTCTGCTGCTCTTAAACTGC
ATGGTTGTGCAGAAGAACCCACAGACAATGAAGATAGTGATAAGAAAGTGGGAGATGATAAAGAGAAGGAGTATGTTCCT
TCATTCAACTCGTATGCCAACAAAGGAAAGAAGAAGTCTGGTACCCAGCAACAAGACCACTATGCATTGTTGGGCTTGAG
CAATTTAAGATATCTTGCGACAGAAGATCAGATAAGGAAAAGCTATCGTGAAGCTGCGCTGAAGCATCATCCTGATAAAC
TCGCTACTCTCCTTTTGGCAGAGGAGACAGAAGAAGCCAAGGAGGCAAAAAAAGATGAGATAGAATCTCGCTTCAAAGCC
ATTCAAGAAGCATATGAGGTATTGATGGACCCAACAAGGAGAAGAATTTTTGACTCCACTGATGAGTTTGATGACGAGGT
CCCGTCGGATTGTTTGCCGCAAGACTTTTTCAAGGTGTTTGGTCCAGCATTTAAGAGAAATGCTAGGTGGTCAGTGAATC
AGCGTATTCCAGATTTGGGAGATGAAGACACACCACTGAAAGATGTTGATAAGTTCTATAACTTTTGGTACGCTTTCAAG
AGTTGGAGGGAATTTCCTGATGAAGAGGAGCATGATCTTGAACAAGCAGATTCCCGTGAAGAACGAAGGTGGATGGAGAA
GGAGAATGCAAAAAAAACTGTGAAGGCTAGAAAGGAGGAGCATGCTCGAATCCGGACTCTTGTTGACAATGCCTATAGAA
AAGATCCGAGAATAGTGAAAAGAAAAGAGGAAGAAAAGGCTGAGAAGCAACAGAAAAAAGAAGCAAAGCTTCTGGCCAAG
AAGAAGCAAGCAGAGGACGCTGCTATTGCTGCTGAAGAAGAGAAAAGGCGAAAAGAAGAAGAAGAAAAGCGAGCTGCTGA
ATCTGCACAACAACAAAAGAAAAATAAGGAAAAAGAGAAGAAACTCTTACGCAAAGAACGGAATCGTCTTAGAACTCTCT
CAGCTCCTCTCGTGGCTCAGCATCTGCTTGACATTTCAGAGGAAGATATAGAGAATCTATGCATGTCACTTAACACCGAG
CAATTGCAGAATCTATGTGATAAAATGGGAAACAAAGAAGGACTAGAATTGGCAAAGGTGATCAAAGATGGTTGCGAGAG
TAGTAGAAATGACGAAGCTGAAACTAAAGAAAAAGAAAGTAAGAAGACCAATGGTGGCACAGAGCCTAAAACCCGAGTCT
CTCAGTTAGATAGTAGTACTCAGAAAAAACAACCATGGAGCAAGGAAGAGATTGATATGCTGAGAAAAGGAATGATAAAA
TATCCAAAGGGGACATCTCGAAGATGGGAAGTTGTTTCAGAGTACATCGGTACAGGAAGATCCGTCGAGGAGATTCTGAA
AGCAACTAAAACAGTTCTTCTACAAAAACCAGATTCCGCTAAAGCATTCGATTCATTCCTCGAGAAGAGGAAACCCTCTG
CTTCAATATCGTCCCCTCTCTCCACAAGAGAGGAGCTCGGAGAATCTCTACCTACGATGACCACAACAAAGGCAAGCCCT
TCTAAAGAGACTGTTGTGGGGAAAAGCTCGAGCAGTCAAGTCTCAGATACCAATGGTGAGGCAGGTGGAAGTTCAGACGC
AGATGGTTGGTCAACTGTGCAAGAAAGAGCTTTGGTTCAAGCTTTAAAGACATTCCCAAAAGAGACAAGCCAAAGATGGG
AGAGAGTAGCTGCAGCCGTTCCTGGGAAAACGATGATTCAATGCAAGAAGAAGTTTGCAGAGCTTAAGGAAATCATTAGA
AACAAGAAAACCGGAGTGTAA