Details for Capsella Locus Carubv10013182m

Position : scaf_3 ( 5`- 5653029 .. 5657172 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013182m

Protein [Map View]
MREDFKRQRKEELERMKEEREMMEKTMKAQKKQQERKKRKAIRKKKYEESLREARRNYRDMADMWARLAQDPNVATALGL
VFFYIFYRVVVLNYRKQKKDYEDRLKIEKAEADERKKMRELEREMEGIEEEDEEVEEGTGEKNPYLQMAMQFMKSGARVR
RASNKRLPEYLERGVDVKFTDVAGLGKIRLELEEIVKFFTHGEMYRRRGVKIPGGILLCGPPGVGKTLLAKAVAGEAGVN
FFSISASQFVEIYVGVGASRVRALYQEARENAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVSLDGFEGRGEVI
TIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILQVHARKKPMAEDLDYMAVASMTDGMVGAELANIVEIAAINM
MRDGRTELTTDDLLQAAQIEERGMLDRKDRSSETWRQVAINEAAMAVTAVNFPDMKNIEFLTINPRAGRELGYVRVKMDH
IKFKEGMLSRQSILDHITVQLAPRAADELWYGEDQLSTIWAETSDNARSAARSLVLGGLSDKHHGLNNFWVTDRINDIDT
EALRILKMCYERAKEILGRNRTLMDEVVQKLVQKKSLTKQEFFTLVELYGSIKPMPPSILELRKIKRLELEETVMKLDMT
TSRNSS*

DNA
ATGAGGGAGGATTTCAAGAGGCAGAGGAAGGAGGAGCTTGAGAGGATGAAAGAGGAAAGAGAGATGATGGAAAAGACTAT
GAAGGCGCAGAAGAAACAACAAGAGAGGAAGAAAAGGAAAGCAATTAGGAAGAAGAAATATGAGGAATCTTTGCGTGAGG
CGAGGAGAAATTATCGAGATATGGCTGATATGTGGGCAAGATTAGCTCAGGATCCTAATGTGGCTACAGCTCTTGGATTG
GTGTTCTTTTATATATTTTATCGTGTGGTGGTGCTTAACTATAGGAAGCAAAAAAAAGATTATGAAGACAGGTTGAAGAT
CGAAAAGGCAGAAGCAGATGAGAGGAAGAAAATGAGGGAATTAGAGAGGGAGATGGAAGGAATTGAGGAAGAGGATGAGG
AGGTTGAAGAAGGAACAGGGGAGAAAAATCCATACTTACAGATGGCAATGCAGTTCATGAAATCAGGCGCACGTGTGAGA
AGAGCATCAAATAAGAGGTTACCTGAGTATCTGGAGAGGGGTGTGGATGTGAAATTTACAGATGTTGCTGGGCTTGGGAA
GATTCGTCTTGAACTCGAGGAAATCGTTAAGTTTTTTACTCATGGAGAGATGTACCGCAGGAGAGGTGTCAAGATTCCAG
GTGGTATTCTTTTATGTGGGCCTCCTGGGGTGGGAAAAACTCTACTAGCAAAAGCTGTAGCTGGTGAAGCAGGAGTGAAT
TTTTTCTCGATCTCTGCATCTCAGTTTGTGGAAATATATGTTGGTGTTGGTGCTTCTCGTGTTCGAGCATTGTACCAGGA
AGCTAGAGAGAATGCTCCATCTGTGGTCTTCATTGATGAACTAGATGCTGTTGGAAGGGAACGTGGGTTGATAAAGGGTT
CTGGAGGACAAGAAAGGGATGCCACACTTAATCAGCTCCTTGTTTCTTTAGATGGTTTTGAAGGAAGGGGAGAGGTCATT
ACCATCGCTTCCACAAACAGACCAGACATTTTAGATCCTGCCCTTGTGAGGCCTGGAAGGTTTGACCGCAAAATCTTTAT
CCCTAAACCTGGTCTTATTGGACGGATGGAAATTCTGCAGGTCCATGCTCGTAAGAAGCCAATGGCTGAAGATTTGGACT
ACATGGCAGTTGCTAGCATGACAGATGGCATGGTTGGAGCAGAGCTTGCTAATATCGTCGAGATAGCAGCAATTAATATG
ATGCGTGATGGAAGAACAGAGTTGACAACAGATGATTTGCTTCAAGCTGCACAAATAGAAGAAAGAGGAATGTTAGATAG
AAAAGACAGAAGCTCTGAGACATGGCGACAAGTTGCTATAAATGAAGCTGCTATGGCTGTTACAGCAGTGAATTTTCCTG
ATATGAAGAATATAGAATTTCTGACGATCAACCCTAGAGCTGGTAGAGAATTAGGTTATGTCCGCGTGAAGATGGATCAT
ATCAAATTTAAGGAAGGCATGCTTAGCCGACAATCCATCCTGGATCACATCACTGTTCAGTTAGCACCTCGGGCTGCAGA
TGAACTGTGGTATGGTGAGGATCAGCTAAGCACGATATGGGCTGAAACATCGGATAATGCAAGATCAGCTGCTCGATCAT
TGGTTCTTGGTGGTCTTTCTGATAAGCATCATGGCTTGAATAACTTCTGGGTGACTGACCGAATTAACGATATTGATACG
GAGGCGTTGCGGATTTTAAAGATGTGTTATGAGCGTGCTAAAGAGATTCTTGGAAGGAACCGGACGCTCATGGACGAGGT
GGTACAGAAACTGGTTCAAAAGAAAAGTCTTACGAAACAAGAATTCTTCACTCTTGTTGAGCTCTATGGCTCCATTAAAC
CAATGCCACCAAGCATCCTTGAACTCAGGAAAATCAAACGGCTTGAGCTAGAAGAGACAGTGATGAAACTGGACATGACT
ACCTCGAGAAACAGTTCATAA