Details for Capsella Locus Carubv10013181m

Position : scaf_3 ( 5`- 6818175 .. 6822440 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013181m

Protein [Map View]
MGTSQSREDRISESDTDSDSEYYEEEEDEDQYDDAKKKQGSSSVSGPSSSGPSDSSSLDIEQKLKALKLKYPSSSSSSVT
PKMKNAVKLYRHIGGNTPKAKWIITDKMTSYKFVKTSTPDGEDIDDYDDCEESGEGGESFWFLGVGSKVKARVSTDMQLK
MFGDQRRVDFVSNGVWALKFLTDEDYRKFVTRFQDYLFENVYKIKASEESRIKVYGKDFIGWANPEAADDSMWEDAEAPP
DEEESEAKQNRDLTEEFEEVANGGVQSLTLGALDNSFLVNDYGVQVYRNMERGIHGKGVCVKFDAGNSKFGSGSSQTTPN
KALLMRAETNMMLMSPAKQGKPNTTGVKQLDIESGKIVSEWKFEKDGTEITMRDITNDTKGSQLDPSESTFLGLDDNRLC
QWDMRDKRGIVQNIESPILEWTQGHQFSRGTNFQCFATTGDGSIVVGSLDGKIRLYSKTSMRMAKTAFPGLGSPITHVDV
SYDGKWILGTTDTYLVLICTLFTDKDGRTKTGFSGRMGNKIPAPRLLKLTPLDSHLAGKDNKFHGGHFSWVTESGKQERH
IVATVGKFSVIWDLERVKNSAHECYRNQQGLKSCYCYKILLKDESIVESRFMHDNFSFSGNKSPEAPLVVATPLKVSSIS
LSGKRL*

DNA
ATGGGTACTTCTCAGAGTCGGGAAGATCGGATCTCTGAATCGGATACGGATTCCGATTCCGAGTACTATGAAGAAGAAGA
AGATGAGGATCAGTACGATGACGCCAAGAAGAAGCAAGGATCATCTTCTGTTTCTGGTCCTTCTTCTTCCGGACCATCTG
ATTCGTCGTCACTCGATATTGAGCAGAAGCTGAAAGCCTTAAAGCTGAAATACCCATCTTCTTCTTCTTCTTCCGTAACG
CCTAAGATGAAGAACGCTGTTAAGCTTTACCGCCATATCGGTGGGAACACACCCAAAGCGAAATGGATCATTACTGATAA
AATGACATCTTACAAGTTCGTTAAGACTTCGACTCCGGACGGAGAGGATATCGATGATTACGATGATTGTGAAGAATCGG
GTGAAGGAGGTGAGTCCTTTTGGTTTCTGGGTGTTGGTTCTAAGGTGAAAGCTAGGGTTTCTACGGATATGCAGTTGAAA
ATGTTTGGGGATCAACGTAGGGTTGATTTTGTGAGTAATGGTGTTTGGGCTTTGAAGTTCTTAACGGATGAGGATTATAG
GAAGTTTGTTACTAGGTTCCAAGACTATCTGTTTGAGAATGTGTATAAGATCAAGGCAAGTGAGGAGAGCAGGATTAAAG
TGTATGGGAAAGATTTCATTGGTTGGGCCAATCCTGAGGCTGCTGATGATTCTATGTGGGAGGATGCTGAAGCTCCACCT
GACGAAGAGGAATCTGAGGCGAAGCAAAATAGGGATTTGACTGAAGAATTCGAAGAGGTGGCTAATGGTGGAGTGCAGAG
TTTGACTTTGGGAGCGTTGGATAATTCCTTCTTGGTGAATGATTATGGGGTTCAGGTTTATAGGAATATGGAGCGCGGGA
TTCATGGGAAAGGTGTGTGCGTTAAATTTGATGCTGGAAACTCCAAGTTTGGATCGGGTTCAAGCCAGACAACACCAAAC
AAGGCTCTTTTGATGAGGGCAGAGACTAATATGATGCTGATGAGTCCTGCTAAACAAGGGAAACCAAACACGACTGGTGT
TAAGCAGCTTGACATAGAATCTGGGAAGATTGTGTCAGAATGGAAATTCGAGAAAGATGGGACTGAAATTACGATGAGAG
ACATAACAAATGATACCAAAGGGTCGCAGCTGGATCCATCAGAGTCTACCTTCTTGGGATTGGATGACAATAGGCTGTGT
CAGTGGGACATGAGGGACAAGAGAGGCATAGTGCAGAACATCGAATCTCCCATCTTGGAATGGACACAAGGCCATCAGTT
TTCTAGAGGAACAAATTTCCAGTGCTTTGCAACTACTGGGGATGGGTCAATCGTTGTGGGATCGCTTGATGGAAAGATAA
GGCTGTACTCAAAGACCTCAATGAGGATGGCAAAAACGGCTTTTCCAGGACTTGGTTCACCAATTACACATGTTGACGTT
TCTTATGATGGGAAATGGATACTGGGCACCACAGATACATACTTGGTTCTTATATGCACCCTTTTCACAGACAAAGATGG
TCGGACCAAAACAGGTTTCAGCGGAAGAATGGGAAACAAAATACCAGCGCCAAGGCTTCTGAAGCTAACACCATTAGATT
CACACTTGGCAGGAAAAGATAATAAGTTTCACGGCGGTCACTTCTCATGGGTAACGGAGAGCGGGAAGCAAGAGAGGCAC
ATAGTAGCAACGGTAGGGAAATTCAGTGTGATATGGGACTTGGAGCGGGTGAAGAATAGCGCACACGAGTGCTATAGGAA
CCAACAAGGACTCAAGAGCTGTTACTGCTACAAGATCTTGTTGAAGGATGAGTCCATTGTTGAGAGCCGATTCATGCACG
ATAACTTCTCCTTCTCTGGTAACAAATCGCCAGAAGCACCGCTTGTGGTTGCCACTCCTTTGAAAGTCAGCTCCATCAGC
CTTTCTGGAAAACGACTTTAA