Details for Capsella Locus Carubv10013179m

Position : scaf_3 ( 5`- 4078154 .. 4081997 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013179m

Protein [Map View]
MVFKRKLDCLSVGFDFPNIPRAPRSCRRKVLNKRSDDDDVDAQICAIDLLALAGKLLQESESSSASSNAFEGNNRDHFGK
EIKQEQDVKCKPINSESSDQGNSVSRPTYDNSTDKCVVNSFSFPDNDGDLERTPMSDYKKTHGLTAVGCENKDVNCDFYV
NSGGITGETGGVNVNTGFKQGEATDRLGDGGLITNTCNLEDATALGVQFPKLVCVGGDLKLPSTMDMTPNGSFARHGNHT
NLGRKDDDEKFYSYLKLSNKFKSYRSPTIRRIRKSLSSKYWKQIPKDFGYSRADVGVKTLYRKRKSCYGYNAWQREINYK
RRRSPDRSSVVTSDGGLSSGSVSKLPEKGDTVKLSIKSFRIPELFIDVPETATVGSLKRTVMEAVSVLLSGGIRVGVLLH
GKKVRDDRKTLSQTGISCDENLDNLGFTLEPGPSKVPLPLCSEDPAEPTDPTNMSERSAASPMLDSGIPHADDVINSGNI
VDNNLEIVPYQCDISADEPLSDSKALVPLPALEVKALAIVPLNQKPKRTELAQRRTRRPFSVTEVEALVQAVEELGTGRW
RDVKLRAFENADHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLRAYGYWSQHQGKHQARGASKDPDMTRGRA
LESGVSV*

DNA
ATGGTGTTCAAGAGGAAGTTGGATTGCTTATCCGTTGGCTTTGATTTTCCCAATATTCCCAGGGCTCCTCGTTCATGCCG
GAGGAAGGTCCTAAACAAGAGGAGTGATGATGATGATGTTGATGCTCAGATCTGTGCTATTGACTTACTCGCTTTGGCTG
GAAAGTTGCTACAGGAAAGCGAGAGTTCCTCAGCGTCTTCCAATGCATTTGAAGGGAATAACCGCGATCATTTCGGTAAA
GAAATTAAACAAGAGCAAGATGTTAAATGCAAGCCTATCAATTCTGAATCTTCTGACCAAGGAAACTCCGTGTCAAGGCC
CACATATGACAACTCTACTGACAAGTGTGTGGTGAACAGTTTTTCATTTCCGGATAATGACGGCGATTTGGAGCGAACTC
CAATGTCTGATTACAAAAAGACTCATGGTTTGACGGCTGTAGGGTGTGAAAACAAGGATGTGAATTGTGACTTTTACGTT
AACTCTGGAGGCATCACTGGGGAGACAGGTGGTGTAAATGTGAATACTGGGTTTAAACAAGGAGAAGCAACCGATCGCTT
GGGAGATGGAGGCTTAATCACTAATACGTGCAACTTAGAGGATGCAACTGCTTTAGGTGTGCAGTTTCCAAAATTAGTCT
GTGTGGGTGGTGATCTAAAATTGCCATCTACCATGGATATGACCCCTAATGGTTCCTTTGCTAGACATGGGAACCATACT
AACTTAGGTAGAAAAGATGATGATGAAAAATTTTATAGTTATCTTAAGCTTAGCAATAAATTTAAGTCGTATAGGTCTCC
AACAATTCGAAGAATAAGAAAGTCACTGTCGTCCAAATACTGGAAGCAAATTCCCAAAGATTTTGGATACAGCAGAGCTG
ATGTGGGTGTAAAGACTCTTTATCGCAAAAGAAAATCATGTTATGGATACAACGCATGGCAGCGTGAGATCAATTATAAG
AGGAGAAGATCACCTGACAGAAGCTCGGTCGTAACTTCTGATGGAGGACTCAGTAGTGGAAGTGTTTCCAAGTTACCAGA
GAAGGGAGATACAGTAAAGCTAAGCATTAAGTCCTTTAGGATTCCAGAGCTTTTTATTGATGTTCCAGAAACTGCAACAG
TAGGATCACTAAAGAGGACCGTGATGGAGGCTGTCAGTGTTTTACTCAGTGGAGGAATACGTGTTGGGGTATTATTGCAT
GGGAAGAAGGTCAGAGATGACAGGAAAACTCTCTCGCAGACTGGGATATCATGTGATGAAAATCTAGACAACCTTGGGTT
CACCTTGGAGCCTGGCCCCAGCAAAGTTCCCCTACCTTTGTGTTCCGAAGATCCTGCTGAGCCAACCGACCCTACAAATA
TGTCTGAACGGTCTGCGGCTTCTCCCATGTTAGATTCTGGAATTCCCCATGCAGATGACGTGATCAATTCAGGAAATATT
GTGGACAATAACCTCGAGATAGTTCCATATCAGTGTGACATATCTGCCGATGAACCTTTATCAGATTCAAAAGCGCTTGT
TCCGCTTCCAGCCTTGGAAGTTAAGGCACTTGCCATAGTTCCGTTGAACCAGAAACCTAAGCGTACTGAGCTTGCCCAGC
GCAGAACCAGGAGACCCTTCTCTGTGACAGAGGTAGAAGCTCTTGTACAAGCAGTGGAGGAACTCGGGACTGGAAGGTGG
CGTGATGTGAAATTGCGTGCTTTCGAGAATGCAGATCATCGGACTTACGTGGACCTGAAGGACAAATGGAAGACGCTGGT
TCACACAGCCAGTATATCACCGCAGCAACGAAGAGGAGAGCCGGTGCCACAAGAACTCCTAGACAGAGTCTTGAGAGCAT
ACGGGTATTGGTCGCAGCACCAAGGAAAACATCAAGCGAGAGGAGCATCCAAAGATCCAGACATGACCAGAGGTAGAGCT
CTTGAATCAGGTGTTTCTGTGTAA