Details for Capsella Locus Carubv10013176m

Position : scaf_3 ( 5`- 1960021 .. 1964449 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013176m

Protein [Map View]
KYIYIRRIPKASTILANDWGKKEKQEAEEEEEEEEEEEENKLIKLRKFEKSCRVVIGLGLMAAAASTSVVCNFPSSVTDS
AARFRSNAFSNKNPPVCVVFSGRPSLEPNNAFVISNSMEVEIRNKENMKIPRTKEFVRNPSLICAPLMANSVDEMVTEMF
KACELGADLVEIRLDALKVFNPLEDLKTIIQQCPLPTLFTYRPKWEGGHYEGNENERQDVLRLAMEFGADYVDVEFQVAS
EFIKSIHGKKPENFKVIVSSHNNENTPCVEDLEDLVARIQQTEADIVKIVTTAVNITDVARVFHITSNSQVPTVGLVMGE
RGLISWILSSKFGGYMTYANLESGKMKALGQPTINDLLDLYNFRQIGTETKVYGVVGNPISHSRSPLIYNRGFKSIGYDG
VYIHLLVDNIASFLGVYSSLDFVGFSCGIPYKEDALKCCDEVDHLANSVGAVNTIRRRESDGKLLGFNTDCYGAIYAIED
GLRTSSDDRSDVLSSSSPLAGKTVVIVGAGGAGRAVAYGAKEKGANVFIANRTYERALELADSVGGKAISLAELDSFHQE
DGMILVNTTAMGMQPNIDATPISKDALKHYSLVFDAVYTPKKTRLLREAEESGATIVFGSEMFVRQALEQFEILTGLPAP
EELFRQIMSKY*

DNA
AAATACATATATATAAGAAGAATACCAAAGGCTAGTACAATACTTGCAAACGACTGGGGAAAAAAAGAGAAACAAGAAGC
AGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAAATAAGCTAATTAAGTTGAGAAAGTTTGAAAAGAGCTGTCGTG
TGGTAATTGGCTTGGGTTTGATGGCAGCAGCTGCTTCGACTAGTGTGGTCTGCAACTTTCCTTCTTCTGTCACTGATTCT
GCTGCCAGGTTCAGATCGAATGCCTTCTCCAACAAGAATCCACCGGTTTGCGTTGTCTTCTCTGGTCGTCCCAGTTTGGA
ACCAAACAATGCTTTTGTGATTTCAAATTCCATGGAAGTGGAGATCAGGAACAAAGAAAATATGAAAATTCCAAGAACCA
AAGAATTTGTGAGGAATCCGAGTTTGATTTGTGCTCCCCTGATGGCGAACTCAGTAGACGAAATGGTGACTGAAATGTTC
AAAGCCTGTGAATTGGGCGCAGACTTGGTTGAAATTAGATTAGACGCTCTCAAAGTTTTCAACCCTCTTGAGGATCTCAA
AACCATTATACAACAATGTCCCCTACCCACTTTGTTCACCTACAGACCAAAGTGGGAAGGTGGTCATTATGAAGGCAATG
AAAATGAACGACAAGATGTTTTACGATTAGCTATGGAGTTTGGAGCTGATTATGTTGATGTTGAGTTTCAGGTTGCAAGT
GAGTTCATCAAATCGATTCATGGAAAGAAGCCTGAAAATTTTAAAGTAATTGTTTCATCACACAACAATGAGAATACTCC
TTGTGTTGAGGATCTCGAAGATCTTGTTGCAAGAATACAACAAACTGAAGCTGACATAGTGAAAATTGTTACGACTGCTG
TTAACATCACAGATGTTGCTCGCGTTTTTCATATAACCTCAAATTCACAAGTTCCGACAGTTGGATTAGTTATGGGTGAA
AGAGGTCTAATATCTTGGATACTAAGTTCGAAATTTGGTGGATACATGACATATGCCAATTTGGAGTCTGGAAAGATGAA
GGCGCTTGGTCAACCAACCATCAATGATCTATTGGATCTTTACAATTTCAGACAGATTGGTACTGAGACCAAAGTATATG
GAGTTGTGGGAAATCCTATAAGTCATAGCAGATCACCTCTTATATACAATCGAGGTTTCAAATCAATTGGCTACGATGGA
GTGTATATCCACTTGTTAGTTGATAATATTGCAAGCTTTCTTGGAGTGTACTCATCTCTTGATTTTGTTGGATTCAGCTG
TGGAATTCCTTACAAGGAAGATGCATTGAAATGTTGTGATGAGGTTGATCATTTAGCAAATTCTGTAGGAGCTGTGAACA
CTATAAGAAGGAGAGAAAGTGATGGAAAATTGTTGGGTTTCAACACGGATTGTTATGGTGCTATTTATGCTATTGAGGAT
GGCTTACGTACTAGCTCTGATGATCGGAGCGATGTTCTTTCTTCGTCGTCGCCATTAGCTGGTAAAACAGTAGTGATCGT
TGGTGCTGGTGGTGCAGGCAGGGCAGTTGCTTATGGTGCAAAAGAAAAGGGAGCTAATGTTTTTATTGCTAATAGGACTT
ACGAACGAGCCTTAGAACTCGCGGATTCAGTTGGAGGCAAAGCCATCTCGCTAGCGGAGTTAGATAGTTTTCATCAAGAA
GATGGGATGATTCTGGTCAACACCACAGCAATGGGCATGCAACCAAATATCGATGCCACGCCCATTTCCAAGGATGCATT
GAAGCACTATTCATTGGTTTTTGATGCGGTATATACTCCGAAGAAGACGAGACTCTTAAGAGAAGCAGAAGAATCAGGAG
CCACGATTGTCTTTGGCTCGGAGATGTTTGTCCGACAGGCTCTTGAGCAGTTCGAGATTTTAACCGGTTTGCCAGCTCCA
GAGGAACTATTCAGGCAAATCATGTCAAAATACTAA