Details for Capsella Locus Carubv10013174m

Position : scaf_3 ( 5`- 5937813 .. 5941299 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013174m

Protein [Map View]
MHFFFVPTSSSSSPSPANTSSFSLLFLAPSQIPDNLCKFSAKINIGTHGISGQSFLMHPPCSSKSTSLCAVVDRSSSGVS
SQQKELTSEGGESNTEGVLVVRRPLLENSDKESSEEEGRKYPARIDAGLSNIAKKMPIFEPERSESSSSSSAAAAARAQE
KPLAVNLDLSLYRAKVLARNFRYKDAEKILEKCIAYWPEDGRPYVALGKILSKQSKLAEARIVYEKGCQATQGENAYIWQ
CWAVLEKKLGNVRRARELFDAATVADKKHVAAWHGWANLEIKQGNISKARNLLAKGLKFCGRNEYIYQTLALLEAKAGRY
EQARYLFKQATISNSKSCASWLAWAQLEIQQERYPAARKLFERAVQASPKNRFAWHVWGVFEAGVGNVERGRKLLKIGHA
LNPRDPVLLQSLGLLEYKHSSANLARALLRRASELDPRHQPVWIAWGWMEWKEGNTTTARELYQRALSIDANTESAARCL
QAWGVLEQRAGNLSAARRLFRSSLNINSQSYVTWMTWAQLEEDQGDSERAEEIRNLYFQQRTEVVDDASWVTGFLDIIDP
ALDTVKRLLNFGQSNDNTRLTTTLKNMGGAKDSQSNQQPESSMGREDTETGSGFKLDAFLREKLSLDPLKLDVNLDSKRL
ERFTRGRINDGD*

DNA
ATGCACTTCTTCTTCGTCCCGACTTCTTCGTCTTCATCACCTTCTCCGGCGAATACTTCTTCATTCTCTCTTTTATTTCT
CGCTCCTTCTCAAATTCCTGATAATCTCTGTAAATTTTCGGCGAAGATCAATATCGGAACCCATGGAATCTCCGGTCAAT
CGTTTCTCATGCATCCTCCGTGCTCCTCTAAGAGCACGTCTCTGTGTGCAGTTGTCGACAGGTCTTCGTCGGGTGTATCA
TCGCAGCAGAAGGAATTGACGAGCGAGGGAGGGGAATCTAACACGGAGGGAGTATTGGTAGTTCGACGGCCGTTGTTGGA
GAATTCCGATAAGGAATCTAGTGAGGAAGAGGGAAGAAAGTATCCAGCGAGGATCGATGCTGGTCTGAGTAATATAGCGA
AGAAGATGCCGATATTTGAGCCGGAGAGATCGGAGTCGTCGTCGTCGTCTTCAGCCGCGGCTGCTGCTAGGGCTCAAGAG
AAGCCGCTTGCGGTGAATTTGGACTTATCTCTGTACAGAGCAAAGGTTCTGGCGAGAAATTTCAGATATAAAGACGCTGA
GAAGATTCTGGAGAAGTGCATAGCTTACTGGCCGGAGGATGGGAGACCATACGTGGCATTGGGGAAGATACTGAGCAAAC
AATCCAAGTTAGCTGAAGCTCGGATCGTGTATGAGAAAGGGTGTCAAGCTACACAAGGAGAGAATGCATATATTTGGCAG
TGTTGGGCTGTCCTGGAAAAAAAGTTGGGAAATGTAAGAAGAGCCAGGGAATTGTTTGATGCAGCTACGGTGGCTGACAA
GAAGCATGTAGCAGCCTGGCATGGATGGGCAAACCTGGAGATTAAACAAGGAAATATTAGTAAAGCCAGGAATCTGCTAG
CCAAAGGCCTCAAGTTTTGTGGCCGAAACGAGTATATCTACCAAACACTTGCCTTGTTGGAAGCCAAAGCTGGCCGGTAT
GAACAGGCTAGGTACCTGTTCAAGCAGGCCACTATAAGCAACTCAAAGAGCTGCGCCAGTTGGTTGGCATGGGCTCAGTT
GGAGATACAGCAGGAAAGATACCCAGCTGCTAGAAAGCTTTTTGAGAGAGCAGTCCAGGCAAGCCCCAAGAATAGGTTTG
CGTGGCACGTGTGGGGGGTGTTTGAAGCTGGAGTAGGTAATGTTGAGCGTGGAAGAAAGCTCCTGAAGATAGGTCATGCG
CTCAATCCTAGAGACCCTGTTCTCCTTCAGTCTCTTGGCTTACTGGAGTACAAACACTCATCTGCTAATCTTGCCCGAGC
TTTACTAAGAAGAGCATCAGAGCTCGATCCTAGACATCAGCCTGTTTGGATTGCTTGGGGTTGGATGGAATGGAAAGAAG
GAAACACAACAACAGCTAGAGAACTTTACCAAAGAGCTCTCTCCATTGATGCAAATACCGAAAGCGCTGCTCGTTGTCTA
CAGGCGTGGGGAGTTCTTGAACAGAGAGCAGGAAACTTATCAGCAGCAAGAAGATTGTTCAGATCTTCATTGAACATTAA
CTCACAGAGCTATGTTACATGGATGACCTGGGCACAACTTGAGGAAGATCAAGGAGACTCCGAACGTGCTGAAGAAATCC
GGAACCTGTATTTCCAACAACGGACGGAGGTTGTTGATGATGCCTCGTGGGTCACAGGATTCTTGGATATCATCGACCCG
GCTTTAGACACTGTTAAAAGGCTCTTGAACTTTGGTCAGAGCAATGACAACACCAGGTTAACAACTACTCTTAAAAACAT
GGGTGGCGCCAAAGATAGCCAATCCAATCAGCAGCCAGAGAGCTCCATGGGACGTGAGGACACTGAAACTGGGAGCGGGT
TTAAACTCGATGCGTTTTTACGCGAGAAGCTGTCGTTGGATCCTTTGAAGCTGGACGTTAATCTTGATTCTAAGAGGTTA
GAGAGATTCACTAGAGGGAGGATAAATGATGGTGATTGA