Details for Capsella Locus Carubv10013172m

Position : scaf_3 ( 5`- 990841 .. 995787 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013172m

Protein [Map View]
MVFKSRIKWIALFVLILSMGSLVVHLSITKSSGVQLAFSARDNLWQDLLGAQDFRNKHLWRPVKSLETLQPYANPRNSYP
APSLKNNGFIYAKIFGGFDKIRSSICDLVTISRLLNATLVIPELQESLRSKGISNKFKSFSYLYDEEQFIAFLKNDVIVT
KALPESLKAARKRNEFPLFKPKNSASPKFYLEDVLPKLKKANVIGLIVSDGGCLQSTLPASMPELQRLRCKVAFHALQLR
SEIQVLGKKMVDRLRKSGQPFLAYHPGLVREKLAYHGCAELFQDIHSELIQYRRAQMIKQKMISEELNVDSHLRRDNGLC
PLMPEEVGILLKALGYSQKAIIYLAGSEMFGGQRVLIPLRAMFPNLVDRTSLCSLEELSDLVGPEIPLPENTFEMPPRKS
DKQLKEEWNKAGPRPRPLPPPPDRPIYQHEKEGWYGWLTENDTEPIPSPMDLRNQAHRLLWDALDFVVSVEADGFFPGFN
NDGSGWPDFSSLVMGQRLYERPSSRTYRLDRKVIQELFNITREDMYHPNRNWTLRVRKHLNSSLGESGLIRQSMLSKPRS
FLSHPLPECSCRTSALDESRQLRSDDGRFLYGGEDECPKWIKSAGVEKSKTDDGDQPDYEHDLLAEQSETEEEFAKSKVA
SAFDQDEEWDPND*

DNA
ATGGTGTTCAAATCTAGAATAAAATGGATTGCGCTTTTTGTTCTCATCTTGTCAATGGGATCTCTGGTTGTTCATCTCTC
CATCACCAAGTCTTCAGGTGTACAGTTGGCGTTTTCTGCAAGAGATAACCTTTGGCAAGATTTGTTAGGGGCACAGGATT
TTAGAAATAAGCACTTATGGCGGCCTGTTAAATCGTTAGAGACCTTGCAGCCTTATGCCAATCCAAGAAATAGTTATCCT
GCGCCCAGTTTAAAAAACAATGGTTTCATTTATGCAAAGATATTTGGTGGATTTGACAAGATAAGATCTTCTATATGTGA
TCTTGTCACCATATCCAGGCTTCTAAATGCTACTCTTGTCATTCCGGAGCTTCAAGAAAGTCTTCGCTCTAAAGGCATTA
GCAACAAGTTCAAGAGTTTCTCCTATCTTTATGATGAAGAGCAATTTATAGCCTTTCTTAAAAATGATGTTATAGTTACA
AAGGCCCTCCCTGAGAGCTTGAAAGCCGCAAGAAAAAGGAATGAGTTCCCTCTTTTTAAGCCCAAAAACTCTGCATCACC
CAAATTTTACCTGGAGGATGTATTGCCAAAGTTAAAGAAAGCTAATGTTATTGGATTGATCGTGTCTGATGGGGGATGCT
TGCAGTCAACTTTGCCAGCTTCAATGCCTGAACTTCAAAGATTAAGGTGTAAAGTTGCCTTCCATGCCCTCCAGCTTCGT
TCAGAAATCCAGGTGCTAGGCAAAAAGATGGTTGACAGGTTACGTAAATCAGGTCAACCTTTCCTAGCTTATCACCCTGG
CTTAGTGAGGGAAAAATTGGCATATCATGGTTGTGCTGAGCTTTTCCAGGACATTCACAGTGAACTCATCCAATATCGGC
GGGCTCAGATGATTAAGCAGAAGATGATTTCAGAAGAACTTAATGTAGACTCGCACTTGCGCAGGGACAATGGCTTATGT
CCTCTCATGCCAGAAGAGGTTGGAATTTTGTTGAAAGCATTGGGTTATTCTCAAAAAGCGATCATATATTTAGCTGGTTC
TGAAATGTTTGGTGGCCAACGGGTTTTGATCCCTCTGCGTGCTATGTTCCCTAATTTAGTGGATAGGACTTCTTTATGCA
GCTTGGAGGAGTTATCAGATTTGGTTGGTCCTGAGATACCTCTTCCAGAAAATACATTTGAAATGCCTCCTCGAAAAAGC
GATAAGCAGCTCAAAGAAGAGTGGAACAAGGCAGGTCCCCGGCCTAGACCTCTACCTCCTCCTCCAGACAGACCTATATA
CCAGCACGAAAAAGAAGGATGGTATGGTTGGCTTACGGAGAATGACACAGAACCAATCCCTTCACCTATGGATCTTAGGA
ATCAAGCACATAGGTTACTGTGGGATGCCCTTGATTTTGTTGTTTCTGTAGAAGCTGATGGGTTCTTCCCCGGTTTCAAC
AATGATGGTAGTGGGTGGCCAGATTTTTCAAGTTTGGTGATGGGTCAAAGGCTCTATGAAAGGCCCTCTTCACGAACATA
TAGACTAGACAGGAAAGTTATTCAAGAACTTTTCAACATTACCCGTGAGGACATGTACCATCCTAACCGTAACTGGACAC
TTCGCGTAAGGAAACATCTTAACTCAAGTTTGGGTGAAAGTGGGCTTATCAGGCAGTCTATGCTGTCGAAACCAAGGTCG
TTTCTTTCGCATCCACTTCCTGAATGTTCATGTAGAACATCAGCCCTTGATGAGTCCAGGCAATTACGGAGTGATGATGG
CAGATTTCTCTATGGAGGTGAGGATGAGTGCCCTAAATGGATAAAATCAGCTGGAGTGGAAAAGAGTAAAACTGATGATG
GTGATCAGCCTGATTATGAACATGATCTTCTCGCTGAACAGTCAGAAACTGAAGAAGAATTTGCAAAAAGTAAAGTGGCT
TCAGCGTTTGACCAGGATGAAGAATGGGATCCTAATGACTAG