Details for Capsella Locus Carubv10013158m

Position : scaf_3 ( 5`- 4285148 .. 4289464 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013158m

Protein [Map View]
MTGMTLELSVLGRSVIDTKALNLKRYGQKSKLSGRLLPRAELHCPVALSSSRNSNLSFRFRRSCEVSYRSRLMLFSSSQC
HEGTQQHSDSAEKELESIKVLLKRGIVVGAVVCGVFLYGCQKVLASAGVVEAGYEVFGQSVVLFKNALPKIYQVLKVLRE
QGLILAALLSLSAFFSMAETSITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIF
GEAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARLVVRPVAWLSLILYPVGRIVTYLSMGILKILGLKGRSEPYVTE
DELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDASGSLVDFHSMWVTHQYSRVPVFEQRIDNIV
GIAYAMDLLDYVQKGDLLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGE
IFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSGFVCEAFGYIPKTGESVKVVLEKES
WEEDGEEEEGKQERQEPKEKHQIYRVEILAGNARKVSAVRFERVNDMDQVSEATDVKSMVPKFVRKWSSEEDDGNLSNEE
DQPENAVLDEHVLADNGKKQQ*

DNA
ATGACGGGCATGACACTTGAGTTATCTGTTCTGGGTCGATCTGTCATTGACACAAAGGCTTTAAATTTGAAGAGATATGG
TCAAAAATCGAAGCTTTCAGGAAGACTTCTTCCGAGAGCTGAGCTTCACTGCCCTGTGGCGTTGTCTTCTTCTAGAAACT
CCAATTTGAGTTTTAGATTCCGACGAAGTTGTGAAGTTAGCTACAGAAGTCGCTTGATGTTGTTTAGCTCGAGTCAATGT
CACGAGGGTACTCAACAGCATTCAGATTCCGCCGAGAAGGAGCTGGAGTCGATTAAGGTTTTGCTGAAACGTGGAATTGT
TGTAGGAGCAGTAGTTTGTGGAGTTTTCTTGTATGGATGCCAAAAAGTTTTAGCATCGGCTGGTGTTGTGGAAGCAGGCT
ATGAGGTGTTTGGTCAAAGCGTTGTGTTGTTTAAGAACGCTTTGCCTAAAATTTACCAAGTTCTTAAGGTTCTTAGAGAG
CAAGGTCTAATATTGGCTGCCCTGCTCAGTCTCTCTGCATTCTTCTCTATGGCAGAAACGTCCATTACCACTTTGTGGCC
GTGGAAGGTGCGTGAGTTGGCTGAGAAAGAGCCAGAGAATGGTGTATTCAGAATGCTCCGGAGTGATGTTACCAGATTCT
TGACGACAATACTTATTGGAACAACTGTTGTGAATATTGCGGCAACTGCCCTGGTCACTGAAGCAGCAACAGCTATATTT
GGGGAAGCTGGTGTTAGTGCAGCAACTGGATTGATGACAGTGGCTATTTTACTCTTGACTGAGATTACTCCAAAAAGTGT
TGCTGTCCACAATGCTCAAGAAGTTGCAAGGCTTGTGGTCAGGCCAGTGGCGTGGCTTTCCTTAATACTATATCCTGTGG
GAAGAATTGTCACATATTTGTCAATGGGAATACTGAAAATTCTTGGTTTGAAAGGACGGAGCGAACCATATGTTACTGAA
GATGAGTTGAAACTGATGCTACGAGGTGCAGAATTAAGTGGCGCCATTGAAGAAGAGGAGCAGGATATGATTGAAAATGT
GCTGGAGATAAAGGATACCCATGTCCGAGAGGTGATGACTCCTCTTGTTGATGTAGTTGCAATTGACGCCAGTGGCAGTC
TAGTTGACTTCCATAGTATGTGGGTGACCCATCAGTACTCAAGGGTGCCTGTTTTTGAGCAGCGTATAGATAACATTGTG
GGAATAGCATATGCTATGGATCTCCTAGATTATGTCCAAAAGGGTGATCTACTAGAAAGTACTTCTGTAGGGGACATGGC
GCATAAACCTGCATACTTCGTCCCTGATTCAATGTCTGTTTGGAATCTTCTTAGAGAATTTCGCATAAGAAAGGTTCACA
TGGCAGTTGTCCTTAACGAATATGGTGGAACCATTGGAATAGTAACTCTTGAAGATGTGGTTGAAGAGATTGTTGGTGAA
ATATTTGATGAAAATGATTCGAAAGAGGAGATTCAGAAGAAAACAGGGTATATTGTCATGAGAGATGAGGGGATATATGA
TGTTGATGCTAATACATCAATAGACCAGCTATCTGAAGAACTAAATATGAAAATGCCTGAGGGCATTCAGTACGAGACAG
TCTCAGGCTTTGTGTGTGAGGCCTTTGGGTATATCCCGAAAACTGGAGAAAGTGTAAAGGTTGTTCTTGAAAAGGAAAGC
TGGGAAGAGGATGGCGAAGAAGAGGAAGGTAAACAGGAGAGGCAAGAGCCAAAGGAAAAGCACCAAATCTATAGAGTAGA
GATACTAGCAGGAAATGCAAGAAAAGTTAGTGCTGTCCGCTTTGAAAGAGTGAACGATATGGATCAAGTGTCGGAGGCTA
CAGATGTAAAAAGCATGGTTCCTAAATTTGTAAGGAAATGGAGTAGCGAAGAAGATGATGGGAACTTGTCCAATGAAGAA
GACCAACCCGAGAATGCTGTCTTAGATGAACATGTATTGGCTGATAATGGCAAGAAACAACAATGA