Details for Capsella Locus Carubv10013154m

Position : scaf_3 ( 5`- 6850629 .. 6853719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013154m

Protein [Map View]
MVVVYRQALLLAFFAFLGFQYLPFSTQAGCPLDLTSSNFTLVASVCSNNADRAQCCRYMNAFVAVSVARYANYSTDLGVP
ADLTEICISTISRTMELYGIPRNATIFCGLGTKILVNYDCEGLTTVTQMLQSITFRDVSKNCRLPLPPGKHCRKCLDSGV
TYLRSLVGADNSIKLSTCRDATYAVLASRVDNSSALELASCFFNVPELSPSPESSPASLSPETSPSPELADSPSSDNLVL
SAIKSHHRYHLTVVPAIGIAVTAFALVMLAVLIVLIQRKKQELDDSKGLECDLKTLPSPRPRSIIHEGNSSAFRKFSYRE
IRKATEDFKMVIGSGGFGTVHKAEFSNGLVAAVKRLNKSSEQAEDEFCREIELLARLHHRHLVALKGFCNKKNERFLVYE
YMANGSLKDHIHSTEKPPLSWETRMKIAIDVANALEYLHFYCDPPLCHRDIKSSNILLDENFVAKLADFGLAHASRDGSI
CFEPVNTDIRGTPGYVDPEYVVTQELTEKSDVYSYGVVLLEIITGKGAVVEGRNLVEMCTPLLLSESRRIDLVDPRIKDC
IDGEQLETVVAVVRWCTEKEGVARPSIKQVLRLLYESCDPLHLGLAMAVEENKGRSLRGDSGFQSGDIRGLASSSSTTSR
SHCSRSFLLETGSPPSPPNGLSF*

DNA
ATGGTGGTGGTTTATAGGCAAGCTCTGCTGCTCGCATTCTTCGCATTTCTTGGATTTCAATACTTGCCTTTTTCCACCCA
AGCAGGTTGTCCATTGGACTTGACTTCATCTAACTTCACTCTCGTGGCTTCTGTTTGCTCAAACAATGCCGACAGAGCCC
AATGCTGCCGCTACATGAATGCTTTCGTTGCAGTATCTGTTGCCCGCTATGCAAACTACAGTACAGATCTTGGAGTTCCA
GCTGATTTGACCGAAATATGCATCAGTACCATCTCTAGAACCATGGAGCTTTATGGAATTCCAAGAAATGCAACTATCTT
CTGTGGTTTAGGGACCAAGATTCTTGTCAACTACGACTGTGAGGGTCTGACCACTGTAACGCAGATGCTTCAGTCCATCA
CGTTTCGAGATGTTTCTAAAAACTGCAGACTCCCACTTCCACCGGGTAAACACTGTAGGAAGTGCTTGGATTCCGGTGTC
ACCTACCTTCGTAGTCTCGTTGGTGCAGATAATAGCATCAAACTGAGCACTTGTCGAGATGCAACTTATGCTGTATTAGC
TAGCCGGGTTGACAATTCATCGGCCCTTGAACTTGCTAGCTGCTTCTTTAATGTGCCTGAGCTTAGCCCCTCTCCAGAGT
CGTCTCCAGCGTCACTGAGCCCAGAAACTTCTCCAAGTCCTGAGCTAGCTGATAGTCCAAGCAGTGATAATCTTGTTTTG
TCTGCAATTAAAAGTCACCATCGATATCACTTGACAGTGGTTCCAGCTATTGGGATCGCTGTTACTGCTTTTGCTCTTGT
TATGCTCGCAGTCCTAATAGTTCTTATCCAAAGAAAAAAACAGGAACTTGATGACTCCAAGGGCTTGGAATGTGATCTAA
AGACGCTTCCTTCTCCCCGCCCAAGGTCGATCATTCATGAAGGTAATTCGTCTGCTTTTCGGAAGTTCAGTTACAGGGAG
ATAAGGAAAGCAACTGAAGATTTCAAAATGGTGATTGGCAGTGGGGGCTTTGGCACTGTTCACAAAGCTGAGTTCAGTAA
TGGGTTGGTCGCAGCTGTGAAAAGGTTGAACAAGAGCTCTGAACAAGCAGAAGATGAATTTTGCAGAGAGATAGAGCTTC
TTGCCAGGCTGCATCACCGCCATCTAGTTGCTTTGAAAGGGTTTTGTAATAAGAAGAATGAGAGGTTCCTTGTCTACGAG
TATATGGCAAATGGGAGCCTCAAGGATCATATACACTCCACAGAAAAACCTCCACTTAGTTGGGAAACTAGGATGAAGAT
CGCAATAGATGTGGCCAATGCTCTGGAATACCTTCATTTCTACTGTGACCCTCCTCTCTGTCACAGAGACATCAAGTCAA
GCAACATATTACTTGACGAAAACTTTGTTGCTAAGCTTGCAGATTTTGGCCTTGCTCATGCTTCTAGAGATGGCTCCATT
TGTTTTGAACCTGTTAATACTGATATTCGTGGAACTCCAGGCTATGTAGATCCAGAGTACGTTGTAACACAAGAACTGAC
AGAGAAGAGTGACGTGTATAGCTACGGAGTGGTGTTGCTAGAGATCATAACTGGGAAAGGAGCAGTCGTTGAAGGTAGGA
ACCTCGTAGAAATGTGTACACCTTTACTGTTATCGGAATCAAGACGGATAGATCTGGTGGATCCGAGAATCAAAGACTGC
ATAGATGGAGAACAGCTTGAAACAGTAGTGGCAGTTGTAAGATGGTGCACAGAGAAAGAAGGTGTGGCTAGACCATCGAT
CAAGCAAGTCCTGAGGCTGTTGTACGAAAGCTGTGATCCGTTGCATCTCGGGCTTGCAATGGCAGTTGAGGAGAACAAAG
GACGGTCGCTGAGAGGTGACTCAGGGTTTCAAAGTGGAGACATCCGTGGCTTGGCTTCTTCCTCTAGTACCACTTCAAGG
TCACATTGTAGCCGGAGTTTTCTGCTCGAGACTGGCTCCCCTCCCTCTCCACCAAATGGTCTTTCTTTTTGA