Details for Capsella Locus Carubv10013103m

Position : scaf_3 ( 5`- 3359207 .. 3368093 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013103m

Protein [Map View]
SEDRTVDLYELLDVLEKLFAGASELKQDSDHWPVATLVGLAGVLCGSNCVSDSANKIKYKRKKRKNDNAVPKLCRIKLLC
GETNPSFCSVDRQVKVSSPSLSLRFSLMPPPRPPSGRGRGRPLRDYSESEKMMDGSGSWDTLEWTKLDSASGSGSFSNLS
CLLESERVVVEGYGVVLINTDEAGTLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKMVLKVQSSPRQSDKNPPRRLL
QVTGKDMRIIVYGFRPRTKQRRSVFDALLKCSKPERVWDLYTFACGPSKFGNANPKERLLNEYFRLLGKSSVRASVDMIE
DGSFTLSNELWRISDLNSNYNLCQTYPFAFMVPKSISDEELLQASSFRARCRLPVITWCQPGSGAVIARSSQPLVGLMMN
MRSNFDEKLVAAFCSQLAGAKGERRKLYIADARPRKNALANGAMGGGSESSSNYFQSEIVFFGIDNIHAMRESFSRLRDY
LDMHGTTSSDGRSSFLRHGGWTWGGGNLSSMSASVSLLGDSGWLIHIQSVLAGAAWIAARVAMESASVLVHCSDGWDRTT
QLVSLACLLLDPYYRTFAGFQALVEKDWLAFGHPFSDRVGMPNISGSGNFDLPRQSSSAGSFPSSPVRQSSGAAASQSSN
SSHGHNNYSPIFMQWIDSVSQLMRMYPCAFEFSPVCMKANTFPDYFMVKFFQ*

DNA
AGTGAGGATCGGACCGTAGATCTTTACGAGCTCCTCGACGTACTCGAAAAACTGTTTGCCGGAGCGAGTGAACTGAAACA
AGATTCGGATCACTGGCCAGTGGCCACCCTGGTGGGCCTGGCGGGAGTTTTATGCGGTTCGAATTGTGTTTCCGATAGCG
CTAACAAAATAAAGTACAAAAGGAAAAAAAGAAAAAACGACAACGCCGTACCAAAACTGTGTCGTATTAAATTGTTGTGT
GGCGAAACAAATCCGTCGTTTTGCTCCGTTGATCGGCAGGTGAAAGTTTCGTCACCGTCTCTTTCTCTCCGTTTCTCTCT
GATGCCGCCGCCGAGACCACCGTCTGGGCGGGGAAGAGGAAGGCCGCTGCGTGATTATTCGGAATCAGAGAAGATGATGG
ATGGTAGCGGTAGTTGGGATACGCTTGAATGGACCAAACTCGATTCAGCTTCAGGGTCAGGCTCTTTCTCGAATTTGAGT
TGCTTGCTGGAATCGGAGAGGGTCGTCGTCGAGGGTTATGGAGTTGTTCTTATTAACACTGATGAGGCAGGAACCTTGTT
GGTGACAAATTTCCGTATTCTGTTTTTGAGTGAAGGAACCAGAAAGGTCATTCCACTTGGAACAATTCCATTGGCAACTA
TTGAGAAGTTTAACAAAATGGTGCTGAAAGTTCAATCAAGCCCCCGTCAGTCTGACAAGAATCCACCAAGACGTCTTTTA
CAGGTCACTGGGAAAGACATGAGGATAATTGTTTATGGCTTTCGTCCTCGAACCAAGCAGAGACGTTCAGTGTTTGATGC
ATTACTAAAGTGTAGCAAGCCAGAGAGAGTATGGGATCTTTATACTTTTGCATGTGGGCCCTCCAAATTTGGTAACGCAA
ACCCAAAGGAAAGATTGCTTAATGAATATTTCCGTCTTCTTGGAAAAAGTTCAGTACGAGCATCAGTGGATATGATTGAA
GATGGTTCGTTCACATTGTCCAATGAGCTGTGGCGGATAAGTGACTTGAACTCCAATTATAACTTGTGTCAGACTTACCC
ATTCGCCTTTATGGTTCCAAAATCCATAAGTGATGAAGAGCTGCTCCAGGCGTCTTCTTTCCGGGCAAGATGTCGTTTAC
CTGTGATCACCTGGTGTCAGCCAGGAAGTGGAGCTGTGATAGCACGCTCATCCCAACCTTTAGTTGGTCTTATGATGAAT
ATGAGGAGTAATTTTGATGAAAAACTTGTTGCTGCATTCTGCTCTCAGTTAGCTGGTGCAAAGGGAGAACGAAGGAAGCT
TTATATTGCCGATGCTAGACCTAGGAAAAATGCATTAGCAAATGGAGCCATGGGAGGCGGCTCAGAATCATCGTCAAATT
ATTTTCAGTCTGAAATTGTTTTCTTTGGCATAGACAATATACATGCAATGAGGGAGAGCTTTTCCCGCCTTAGAGATTAT
TTAGATATGCACGGTACAACATCATCTGATGGGAGATCATCGTTCTTGAGACACGGTGGTTGGACCTGGGGAGGAGGCAA
TCTGAGTAGTATGTCTGCTTCAGTATCTTTACTTGGAGACAGTGGATGGTTGATACATATCCAGAGCGTTTTAGCTGGCG
CAGCTTGGATTGCTGCACGTGTTGCTATGGAGTCGGCATCAGTTCTTGTGCACTGCAGTGATGGATGGGACAGAACAACT
CAGCTGGTTTCTCTTGCATGCTTATTACTTGATCCATACTACAGGACTTTTGCTGGGTTTCAGGCTCTTGTCGAAAAGGA
TTGGCTTGCCTTTGGTCACCCGTTTTCGGATCGTGTAGGAATGCCTAACATATCAGGATCGGGTAATTTTGACTTACCAA
GGCAGTCTTCTTCTGCTGGAAGTTTCCCTTCATCTCCTGTGCGTCAGTCTTCAGGAGCAGCAGCTTCACAATCTTCGAAC
TCTTCCCATGGGCATAACAATTATTCACCTATATTTATGCAGTGGATTGATAGCGTTTCACAGCTAATGCGGATGTATCC
TTGTGCTTTTGAATTTTCTCCGGTATGTATGAAGGCAAACACATTTCCTGACTATTTCATGGTCAAATTCTTCCAGTAA