Details for Capsella Locus Carubv10013102m

Position : scaf_3 ( 5`- 6424529 .. 6428504 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013102m

Protein [Map View]
MSSKTRNMLEGLVKDTSFKWFLGKQSSFDEEIEEMGRSPSAGTNWIPELSPVANVVVRRCSKILGVPANELRDSFKQEAF
ESLKQPSLFARNFLEYCCFRALSLSVGVTGHLADKKFRRLTFDMMVVWEVPAVASQALLSVEEDATVSLEAFSRIAPAIP
IIADVIICENLFETLTSSTGGRLQFSVYDKYLYGLERAIKKMRAQSESSLLSGVRSKREKILEIDGTVTTQPVLEHVGIS
TWPGRLILTDHSLYFEALKVVSYDKPKRYDLSEDLKQIVKPELTGPWGTRLFDKAVSYTSISLSEPVVMEFPELKGHTRR
DYWLTIIREVLYVHRYIKEYRITSLARDEALSKAVLGIIRVQAIQELSLTNAMRYENLLPFNLCNQLPGGDLILQTLAEM
STLRELHRSNKSKDTGTLHSSASDMVSQLGSVFGGSSPRSRMSGTSSLLVGEVVVGDVNPLERAVKESRKNYEKVVLAQE
TINGVKMDGIDTNLAVMKELILPIMETGNWIVSVVYWDDPMKSIVFCLVSTFIIWRGWLVYVFSLASLFSAIFMVLTRCF
SREKLMIELKVIAPPPMNTMEQLLAVQNGILELEQNIQDANIVLLKFRALLFSLFPQASEKFAIAIVVAATMMAFVPGRY
LLSVVFVELFTRYSPPRRASTERLIRRLREWWFSIPAAPVVLHHDKNNKKKN*

DNA
ATGTCTAGCAAAACCCGGAATATGCTTGAAGGTTTGGTTAAGGATACTTCCTTTAAATGGTTTCTCGGGAAGCAAAGTTC
TTTCGATGAAGAAATTGAGGAAATGGGAAGATCCCCATCTGCTGGCACCAATTGGATACCTGAGCTTTCTCCTGTGGCTA
ATGTCGTTGTCCGCAGGTGTTCAAAGATACTCGGTGTTCCTGCAAACGAGCTGCGAGATAGTTTCAAACAAGAGGCATTT
GAATCTCTCAAGCAGCCCTCTCTATTTGCAAGGAATTTTCTAGAGTACTGTTGTTTTAGAGCACTTTCACTCTCTGTGGG
AGTAACAGGTCATCTAGCCGATAAAAAGTTTCGGCGCTTAACCTTTGACATGATGGTTGTGTGGGAAGTCCCAGCTGTTG
CTAGCCAGGCTTTACTCAGCGTTGAAGAGGATGCAACAGTGAGTTTAGAAGCCTTCTCACGGATCGCACCAGCAATTCCT
ATAATAGCTGATGTGATCATATGTGAAAATCTGTTTGAAACGCTTACTTCATCAACGGGTGGTCGGCTTCAGTTCTCTGT
TTATGACAAATATTTATATGGACTTGAGAGAGCAATAAAGAAGATGAGGGCTCAGTCAGAATCATCTTTGCTTTCTGGTG
TTCGATCAAAAAGAGAAAAGATTCTGGAAATAGATGGGACAGTTACTACCCAACCAGTTCTTGAACATGTTGGAATATCA
ACATGGCCAGGTCGCTTGATCCTGACAGACCATTCACTATATTTTGAGGCCTTAAAAGTCGTGTCTTATGATAAACCAAA
GCGATATGACCTATCGGAAGATCTAAAGCAAATAGTTAAACCTGAGTTAACTGGTCCTTGGGGAACTCGGCTTTTCGACA
AGGCTGTTTCTTACACATCTATATCTCTATCAGAACCAGTGGTAATGGAATTTCCAGAGCTCAAAGGCCACACCCGCCGC
GATTACTGGCTCACTATTATACGAGAAGTATTATACGTTCACAGATACATAAAGGAGTACAGGATCACCAGTTTGGCAAG
AGACGAAGCACTTTCAAAGGCTGTCCTTGGCATCATACGTGTGCAAGCTATTCAAGAACTCAGTTTGACAAATGCAATGC
GTTACGAAAATCTTCTTCCGTTCAATCTCTGCAATCAGCTTCCTGGTGGAGATCTGATTCTTCAGACGCTTGCAGAGATG
TCTACTTTAAGAGAGCTCCACCGATCAAATAAATCCAAAGATACAGGGACATTACATTCATCAGCTTCAGATATGGTTTC
GCAGCTGGGTTCTGTGTTTGGAGGATCAAGTCCTAGGAGCAGAATGAGTGGGACAAGTAGTCTTTTGGTAGGTGAAGTAG
TGGTTGGTGATGTGAATCCATTAGAGAGAGCAGTGAAGGAGTCGCGTAAGAACTACGAGAAAGTAGTGCTAGCGCAAGAG
ACGATTAATGGAGTCAAAATGGATGGCATTGACACCAACTTAGCCGTGATGAAGGAACTGATTCTTCCTATTATGGAAAC
AGGGAACTGGATTGTGTCGGTGGTGTATTGGGATGATCCTATGAAGTCTATTGTTTTCTGTCTCGTCTCCACCTTCATAA
TTTGGAGGGGGTGGCTTGTCTATGTCTTTTCTCTTGCGTCTCTCTTCTCTGCAATCTTCATGGTTCTCACAAGATGTTTC
AGCAGAGAAAAGCTCATGATCGAGCTGAAAGTAATTGCTCCCCCACCAATGAACACAATGGAACAGCTTTTGGCGGTTCA
GAATGGGATCTTGGAGCTCGAACAGAACATTCAAGACGCAAACATAGTTCTTCTTAAGTTCCGAGCTTTGTTATTCTCGC
TTTTCCCTCAGGCGAGCGAGAAGTTTGCAATTGCGATAGTAGTAGCGGCAACGATGATGGCTTTTGTTCCGGGACGCTAC
TTGCTTTCAGTGGTGTTTGTTGAGCTATTCACAAGATACTCGCCTCCACGGAGAGCTAGCACGGAACGGTTGATAAGGCG
GTTGAGAGAGTGGTGGTTTAGTATACCAGCGGCTCCAGTGGTCCTCCATCACGACAAGAACAATAAGAAAAAGAACTAA