Details for Capsella Locus Carubv10013092m

Position : scaf_3 ( 5`- 7061539 .. 7067166 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013092m

Protein [Map View]
MILQSSSSCPSFDLSHAYVSRRMLCPCSNEHGLIVFCDGFARRRLLRRNFRVHAANANSNSNLRFVSSGIRSSDAKNIGL
ADSARRTARSLVVTRFSNEFEDEDVSSSSQESVIQGDRSNFTNFREDPIVDKLRTQLGVIHPIPTPPISRNAIGLFAFFF
FVGVICDKLWTWRKRRRQMSSDGGQRGAGPWAQVPTSFALSLEKDLQRKESVEWVNMVLVKLWKVYRGGIENWLVGLLQP
VIDDLKKPDYVQRVEIKQFSLGDEPLSVRNVERRTSRRVNDLQYQIGLRYTGGARMLLMLSLKFGIIPIVVPVGIRDFDI
DGELWVKLRLIPSAPWVGAASWAFVSLPKIKFELAPFRLFNLMGIPVLSMFLTKLLTEDLPRLFVRPKKIVLDFQKGKAV
GPVSEDSKSGEMQEGNKDFVGELSVTLVNAQKLPYMFSGRTDPYVILRIGDQVIRSKKNSQTTVIGAPGQPIWNQDFQFL
VSNPREQVLQIEVNDCLGFADMAIGNGEVDLESLPDTVPTDKIVSLRGGWSLFGKGSAGDILLRLTYKAYVEDEEDDKRN
AKVTYADASDDEMSDSEEPSSFVQNDKIPSDDISQESFMNVLSALILSEEFQGIVSSESGNNKLDDGESIVTPVPSKAGA
DPKSQPKDPGNANISDLEVNTASSDRGSIGDGGLALLWFSVITSVLALVAINMGGSSFFNP*

DNA
ATGATTCTACAATCTTCTTCTTCTTGTCCTAGTTTCGATTTGTCCCACGCTTATGTGTCTCGTCGTATGCTTTGTCCCTG
CTCCAATGAGCACGGCCTGATTGTGTTCTGCGATGGCTTCGCGAGGAGGCGGCTTCTCCGTCGGAATTTTAGAGTCCATG
CGGCTAATGCGAATTCGAATTCGAATTTGAGGTTTGTTTCCAGCGGGATTCGTAGTAGTGATGCGAAGAACATAGGATTA
GCGGATTCTGCGAGAAGAACTGCGAGAAGTCTCGTGGTTACTCGATTTTCAAATGAATTCGAGGATGAAGATGTATCGTC
GTCTTCGCAGGAGTCTGTAATTCAAGGTGACCGAAGCAATTTCACTAACTTTAGAGAAGACCCGATTGTGGATAAGCTCA
GGACTCAGCTAGGTGTAATCCATCCAATCCCCACGCCACCGATTAGTCGTAATGCCATTGGTTTGTTCGCCTTCTTCTTC
TTTGTTGGTGTTATTTGTGACAAGCTATGGACCTGGAGAAAGAGGCGGAGGCAAATGAGCAGTGACGGAGGCCAAAGAGG
AGCCGGGCCATGGGCACAGGTTCCCACTAGCTTTGCGCTGTCCCTTGAGAAGGATTTGCAAAGGAAAGAGTCGGTGGAGT
GGGTTAATATGGTGTTGGTAAAGCTCTGGAAAGTTTATAGAGGTGGGATTGAGAATTGGCTTGTTGGATTGTTGCAGCCA
GTTATTGATGACTTGAAGAAGCCAGATTACGTGCAAAGGGTTGAAATAAAGCAATTCTCTCTTGGGGATGAGCCTTTGTC
TGTTAGAAATGTTGAGAGGAGGACATCCCGCCGTGTCAATGACTTACAGTACCAGATTGGTCTTCGATATACTGGTGGTG
CGCGGATGTTGTTAATGCTCTCTTTAAAATTTGGTATCATCCCAATAGTCGTGCCAGTCGGTATTCGGGATTTTGACATT
GACGGTGAGCTATGGGTTAAATTAAGACTGATTCCCTCTGCGCCTTGGGTTGGAGCAGCATCATGGGCTTTTGTATCACT
TCCAAAGATCAAATTTGAGCTTGCACCATTCCGACTATTTAATCTAATGGGAATTCCTGTTCTATCAATGTTCTTGACCA
AACTGCTGACAGAAGATTTGCCTCGATTATTTGTCCGCCCAAAGAAAATTGTCTTGGATTTCCAGAAAGGAAAAGCTGTT
GGCCCTGTTTCAGAAGACTCAAAGTCTGGAGAAATGCAGGAAGGGAACAAGGATTTTGTTGGGGAACTTTCTGTTACTCT
TGTAAATGCCCAAAAACTTCCATACATGTTCTCTGGTAGAACAGATCCATATGTTATTCTACGAATAGGTGATCAAGTTA
TCCGCAGTAAAAAGAACAGTCAAACTACAGTGATTGGGGCTCCTGGTCAGCCAATCTGGAATCAGGATTTCCAATTCCTT
GTTTCAAATCCTAGAGAGCAAGTATTACAAATTGAAGTTAACGACTGTCTTGGATTTGCCGATATGGCTATTGGTAACGG
AGAGGTGGACCTTGAATCACTGCCAGATACGGTTCCTACAGACAAAATTGTTAGTTTGCGAGGCGGATGGAGTTTGTTCG
GAAAGGGATCTGCTGGAGATATACTACTCCGGCTTACATACAAAGCATATGTGGAGGATGAAGAAGATGATAAACGCAAT
GCAAAAGTCACTTATGCAGATGCTTCTGATGATGAAATGTCTGATTCGGAAGAACCTAGCTCATTCGTGCAGAATGACAA
GATTCCTTCTGATGATATTAGTCAAGAGTCATTTATGAATGTGCTGTCTGCATTGATTTTGAGTGAGGAATTTCAAGGCA
TAGTTTCATCAGAATCTGGGAACAATAAACTTGATGACGGTGAATCAATCGTGACACCAGTTCCTTCAAAGGCTGGGGCG
GATCCAAAATCTCAACCGAAGGATCCTGGGAATGCCAATATATCAGATTTAGAAGTGAACACTGCGAGTTCCGATAGAGG
TTCTATTGGTGATGGAGGATTAGCATTGTTGTGGTTCAGTGTAATCACTTCTGTACTGGCACTCGTTGCTATCAACATGG
GCGGCTCAAGTTTCTTCAACCCGTAA