Details for Capsella Locus Carubv10013089m

Position : scaf_3 ( 5`- 1127102 .. 1130238 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013089m

Protein [Map View]
MDRPPSFPHNQNPNPNFFHHYPPPNPNPNFFFRPPPPPLQNPNTYSIAPSPPPIRELSGTITSLQSLLSECQRTLDSLSQ
NLALDHSYLLQKGGNGGFVRCPFDSNHFMPPEALFLHSLRCPNPLDLTHLLGSFSSYRNTLELPSQVQLSNDAGDLCVSL
DELADFGTNFFYKDCPGAVNFSELDGIKPTLTLPNILSLECSDLQVADEKENNSMLGILPSDLCAIKSEINQWRDYPNSY
SYSVLSAMLGSKAIETSELNSWILVNSTRYGVIIDTYMRDHIFLLFRLCLKSVVKEACGFMMEPDANGVGEQQIMSCKSR
IFECPVLVRVLSWLASQLAVLYGEGNGKFFALDMFKQCIVESASQIMLFRSERSTPQSSGALEGLDDARLSNKDVKMEKP
CENSALDSAQVISVSRVAAAVAALNERSMLEGKIRAIRYAQPLTRYQRLAEIGVMRAKAEEERKRRSSYRPIIDHDGLPR
QRSSNQDMNKIKTREELLAEERDYKRRRMSYRGKKVKRTPRQVLRDIIEEYTEEIKLAGGIGCFEKGMPLQSLSSVGNDQ
KESDVGYSSAPSTLTDASSKFYKQRKEENRADTEYSKDNRNNIDKVNRHEEYDSGSSQRQRRHRSYKHSDQRHDKHSDRR
DDEFTRNKQHSLEKKSSHQNHRSSREKSSSDYKTKRDDSYDRRSREPRNQNSFEDRYNPTERE*

DNA
ATGGATCGACCACCGTCGTTTCCGCACAATCAAAACCCTAATCCGAACTTCTTTCACCATTATCCTCCTCCAAACCCTAA
TCCTAATTTCTTCTTTCGACCTCCTCCACCTCCTCTTCAGAATCCTAACACTTACTCCATTGCTCCATCTCCGCCGCCGA
TTCGCGAGCTCTCCGGTACTATCACCTCTTTACAATCACTGTTGTCGGAATGTCAAAGAACCTTAGATTCTCTCTCGCAA
AATCTAGCTTTAGACCACTCTTATCTTCTCCAGAAGGGCGGAAATGGCGGTTTCGTTCGTTGCCCTTTTGATTCAAATCA
CTTTATGCCACCCGAAGCTCTCTTTCTCCACTCACTCCGTTGCCCAAATCCTCTTGACCTCACTCACCTTCTTGGATCTT
TTAGTAGTTACCGGAACACACTCGAATTACCCTCTCAAGTACAGCTGAGCAATGATGCTGGAGATCTCTGTGTCTCCTTA
GATGAGTTAGCTGATTTTGGAACTAATTTCTTCTACAAAGATTGTCCAGGAGCTGTGAACTTCTCTGAGCTCGATGGAAT
AAAGCCAACTTTAACACTTCCTAACATTCTATCTTTGGAATGTAGCGATTTGCAAGTTGCTGATGAGAAGGAGAATAATA
GTATGTTAGGGATTCTACCGTCTGATCTCTGTGCAATAAAGAGTGAGATTAATCAATGGAGGGATTACCCAAATTCGTAT
TCCTATAGTGTTCTTTCTGCTATGCTGGGTTCAAAAGCGATTGAAACAAGCGAGTTGAACTCATGGATTCTGGTTAATTC
TACGAGATATGGTGTAATAATTGATACTTACATGAGGGATCATATATTCTTGCTCTTCCGGTTGTGTCTGAAATCGGTTG
TGAAAGAAGCTTGTGGATTTATGATGGAGCCTGATGCCAATGGCGTTGGTGAGCAGCAGATTATGAGCTGCAAAAGTAGA
ATATTTGAGTGTCCAGTCTTGGTTCGAGTGTTGTCTTGGTTAGCTTCTCAACTTGCTGTCTTATATGGAGAAGGAAATGG
GAAGTTTTTTGCTCTAGATATGTTTAAACAGTGCATAGTAGAATCTGCCTCTCAAATAATGTTGTTTCGGTCAGAAAGAA
GCACACCTCAATCCTCTGGAGCACTCGAGGGTTTGGATGATGCAAGGTTGAGTAATAAGGATGTGAAGATGGAGAAACCC
TGCGAGAATAGTGCTTTGGACAGTGCTCAGGTGATATCTGTGTCCCGTGTTGCAGCAGCTGTTGCAGCATTGAATGAAAG
ATCCATGCTTGAAGGGAAAATTAGGGCAATACGATATGCCCAACCACTAACAAGATATCAGCGGCTGGCCGAGATTGGTG
TTATGAGAGCTAAAGCTGAGGAAGAACGGAAAAGACGTTCTAGCTACCGACCTATTATTGATCATGATGGTCTTCCAAGG
CAACGCTCATCAAATCAGGATATGAATAAAATAAAGACAAGAGAAGAGCTTTTAGCTGAAGAGAGAGATTACAAGCGTAG
GAGAATGTCATACCGTGGTAAGAAGGTGAAACGTACGCCTAGACAGGTGTTACGTGATATAATAGAAGAATATACAGAAG
AAATTAAGCTAGCAGGAGGGATTGGATGTTTTGAGAAAGGAATGCCATTACAATCCCTGTCTTCTGTAGGCAACGATCAG
AAAGAAAGTGACGTTGGATACAGTTCTGCACCATCAACATTAACAGATGCATCATCAAAATTCTATAAGCAACGGAAAGA
AGAGAACCGTGCAGATACTGAATATTCAAAGGATAATAGAAACAATATAGATAAAGTAAACCGGCATGAGGAGTATGATT
CAGGTAGCTCGCAGAGACAGCGGAGGCACAGGTCATATAAGCACAGTGATCAAAGACATGACAAGCACAGTGATCGAAGA
GATGATGAATTCACAAGGAACAAACAACATAGCCTCGAAAAGAAGTCTTCTCATCAAAACCACAGATCATCTCGTGAGAA
GAGTTCATCAGATTACAAGACCAAAAGGGATGATTCTTATGACCGCCGCAGTCGGGAACCTAGGAATCAAAATTCGTTTG
AAGATAGATACAATCCAACAGAAAGGGAGTGA