Details for Capsella Locus Carubv10013086m

Position : scaf_3 ( 5`- 3265331 .. 3268560 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013086m

Protein [Map View]
MELCNQNNGVSGDPLNWNAAADALKGSHLEEVKRMVEDYRKGLVKLGGETLTIGQVAAVARGGGGSTVELAEEARAGVKA
SSEWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQNELIRFLNAGIFGTGAGDTSHTLPKPTTRAAMLVRVNTLLQGY
SGIRFEILEAITKLLNHEITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILSASDAFKLAGVSTFFELQP
KEGLALVNGTAVGSGLASTVLFEANILAVLSEVMSAMFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILYGSSYVK
EAQLLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVAMDNS
RLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNS
LGLISSRKTAEAVDILKLMSTTYLVALCQAVDLRHLEENLKKAIKSAVSQVAKRVLTVGVNGELHPSRFTERDVLQVVDG
EYVFSYADDPCSITYPLMQKLRHILVDHALADPEREANSATSVFQKIGTFESELKLLLPKEVERVRVEYEEGLSAIANRI
KECRSYPLYRFVRDELETELLTGENVRSPGEMFDKVFSAMSDGKLIDPLLECLKEWNGAPIPIY*

DNA
ATGGAGCTTTGCAACCAAAACAACGGCGTCAGCGGCGATCCGTTAAACTGGAACGCGGCGGCGGATGCTTTGAAAGGGAG
CCACTTGGAGGAGGTGAAACGAATGGTGGAAGATTACAGGAAAGGGTTGGTGAAGTTAGGAGGAGAGACGTTGACGATTG
GTCAAGTTGCCGCCGTGGCTAGAGGAGGAGGAGGATCTACGGTGGAGCTAGCGGAGGAGGCACGTGCCGGAGTCAAGGCG
AGTAGCGAGTGGGTGATGGAGAGCATGAACCGAGGAACGGACAGTTACGGAGTCACCACTGGGTTTGGTGCAACTTCCCA
TAGAAGAACCAAACAAGGCGGTGCTCTTCAAAATGAGCTTATTAGGTTCTTAAACGCCGGAATATTTGGCACCGGCGCCG
GAGACACGTCACACACGCTGCCTAAACCGACAACGAGAGCGGCAATGCTCGTCCGTGTCAACACTCTTCTCCAAGGCTAC
TCTGGGATACGCTTCGAGATTCTCGAAGCCATTACAAAGCTTCTCAACCACGAAATCACTCCGTGCCTCCCTCTCCGTGG
CACCATAACCGCTTCCGGCGACCTTGTCCCACTGTCTTACATAGCTGGACTCCTCACCGGCCGTCCTAACTCCAAAGCCG
TGGGTCCTTCCGGTGAGATTCTCTCTGCCTCTGACGCCTTTAAGCTCGCCGGAGTATCGACCTTCTTCGAGCTGCAGCCT
AAGGAAGGACTTGCGCTTGTGAACGGGACAGCGGTTGGATCGGGTTTGGCCTCAACGGTTCTGTTCGAGGCAAATATTTT
GGCGGTTTTGTCCGAAGTTATGTCCGCCATGTTTGCTGAGGTTATGCAGGGGAAACCGGAGTTCACCGATCACCTTACCC
ATAAACTGAAGCACCACCCTGGTCAGATAGAAGCCGCAGCAATTATGGAACATATATTATACGGAAGCTCTTACGTTAAG
GAAGCTCAACTTCTTCACGAAATGGATCCTCTTCAAAAACCTAAACAAGATCGGTATGCATTACGTACGTCACCGCAATG
GCTTGGGCCTCAGATCGAAGTGATTAGAGCGGCAACAAAAATGATTGAGCGAGAGATCAACTCAGTTAATGATAACCCTT
TGATCGATGTTTCAAGGAACAAAGCTTTGCACGGTGGGAATTTCCAAGGGACACCGATTGGTGTCGCCATGGATAATTCT
CGTCTAGCCATTGCTTCGATCGGGAAACTCATGTTTGCGCAGTTCTCTGAACTTGTTAACGATTTCTACAATAACGGTTT
GCCTTCTAATCTATCCGGTGGAAGAAACCCTAGTCTTGATTACGGTTTCAAAGGCGCTGAAATAGCCATGGCTTCTTATT
GCTCTGAGCTCCAGTTCTTGGCTAATCCCGTGACCAACCATGTCCAAAGCGCGGAGCAGCATAACCAAGATGTTAATTCC
CTCGGATTGATCTCGAGCCGTAAAACCGCGGAAGCAGTCGATATCCTCAAGCTAATGTCCACGACTTACTTAGTCGCGCT
TTGCCAAGCAGTTGATCTAAGACACCTAGAAGAGAATCTGAAGAAAGCGATTAAATCCGCGGTGAGCCAGGTGGCGAAGC
GGGTCTTGACCGTTGGTGTAAACGGTGAGCTACATCCGTCGAGGTTCACTGAACGTGATGTCCTCCAAGTGGTTGACGGA
GAGTACGTGTTCTCCTACGCAGACGATCCATGTAGCATCACTTATCCCCTGATGCAGAAACTTAGACACATTCTTGTAGA
CCACGCTTTGGCGGATCCAGAACGCGAAGCCAATTCCGCGACATCAGTTTTCCAAAAGATCGGAACCTTCGAGTCGGAGC
TGAAACTGCTTCTCCCAAAAGAAGTGGAACGTGTCCGGGTTGAGTACGAGGAAGGATTATCGGCTATAGCTAACCGGATT
AAAGAGTGTAGGTCTTATCCGCTGTACCGGTTCGTCAGAGATGAGCTGGAGACAGAGTTGCTTACCGGAGAGAATGTTAG
GTCACCGGGAGAGATGTTTGATAAAGTGTTCTCGGCGATGTCTGATGGAAAACTTATTGATCCTTTGTTGGAATGTCTCA
AGGAGTGGAACGGAGCTCCGATCCCCATCTATTAA