Details for Capsella Locus Carubv10013083m

Position : scaf_3 ( 5`- 6087436 .. 6091323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013083m

Protein [Map View]
MAPLGSIGVVDPGWEHGVAQDERKKKVKCNYCGKIVSGGIYRLKQHLARVSGEVTYCDKSPEEVCLRMKENLERCRSTRK
LRQPGDNNRQSCSSFHQSNNDDEAEEEEPRCWSRRSKGKLSLSDGSILRSSGYIDPGWEHGVAQDERKKKVKCNYCNKIV
SGGINRFKQHLARIPGEVAPCKTAPEEVYVKIKENMKWHRAGKRQNRPDDEMGALNFRTVSQDPEQEEDGEEQDIYPISQ
DRLMLGNGRFSKEKRKSFDSVNIRSLSEARPRRARVIPYQSPSSSKQRKIYTSCSNRVVSRKDVTSSISKFFHHVGVPTE
AASSLYFQKMIELIGLHGEGFVVPSSHLFSGRLLQEEISTIKSYLREYRSSWGVTGCSIMADTWTNTEGKKMISFLVSCP
RGVYFHSSIEATHIIEDASSLFKCLDKLVDDIGEENVVQVITQNTAICRNAGKLLEEKRKNMYWTPCAMHCTELVLEDIS
KLEFVSDCLEKAQRITRFIYNQTWLLNLMKNEFTRGQDLLRPAVMRYASGFTTLQSLMDHKASLRGLFQSNGWILSQTAA
KSEEGREVEMMVSSVAFWKKVQYVLKSVDPVMQVIRMIDDGGERVSLPYAYGYMCCAKMAIKSIHSDDGRKYLPLWRVID
YHWNPLFHHPLYVAAYFFNPAYRYRPDFMSVGMIISYFMQSLKLSVISLRFAVNVKNICSSLRSCAE*

DNA
ATGGCTCCACTTGGATCAATTGGAGTGGTCGACCCTGGATGGGAGCACGGTGTTGCACAAGACGAACGGAAGAAGAAGGT
TAAATGCAATTACTGTGGAAAGATAGTAAGCGGAGGAATATACAGATTAAAGCAACACTTGGCTCGGGTATCAGGAGAAG
TGACCTATTGTGATAAGTCTCCAGAAGAAGTATGTCTGAGGATGAAGGAGAATCTAGAACGGTGTCGTTCCACCAGAAAG
CTGAGGCAGCCTGGGGATAACAATAGACAGTCTTGTTCCAGTTTCCATCAATCTAACAATGACGATGAAGCAGAGGAGGA
AGAGCCGCGGTGCTGGTCTAGAAGAAGCAAGGGAAAGCTAAGCTTGAGTGATGGGAGTATTCTTCGGTCGTCAGGTTATA
TTGATCCTGGATGGGAACATGGTGTTGCTCAGGATGAGAGGAAAAAGAAAGTGAAATGTAATTACTGTAACAAGATAGTG
AGTGGTGGTATTAACCGTTTTAAACAGCATCTTGCAAGAATACCTGGAGAGGTAGCGCCATGTAAAACCGCTCCAGAGGA
GGTTTATGTTAAGATTAAAGAGAATATGAAATGGCATCGAGCTGGGAAGAGACAGAACAGACCTGATGATGAAATGGGAG
CTTTAAACTTCAGAACGGTGTCTCAGGATCCTGAGCAAGAAGAAGACGGGGAAGAACAAGACATCTATCCAATCAGCCAA
GATAGGTTGATGCTGGGAAATGGAAGGTTTAGTAAAGAAAAAAGAAAGAGCTTTGATTCAGTGAACATTAGATCTCTTTC
TGAAGCAAGACCAAGAAGAGCGAGAGTTATCCCGTATCAGTCACCTTCTTCGAGCAAGCAGAGGAAAATATACACTAGCT
GTTCAAATAGAGTTGTATCACGAAAAGACGTCACATCCTCCATTTCCAAATTCTTCCACCATGTAGGAGTTCCCACAGAG
GCAGCAAGTTCTCTGTACTTTCAAAAGATGATTGAATTGATTGGTCTGCACGGAGAGGGTTTCGTTGTGCCCTCGAGTCA
TCTGTTTTCCGGTAGGCTCTTACAGGAAGAGATTTCAACTATCAAAAGCTATTTGAGGGAGTACAGATCTTCTTGGGGGG
TTACAGGTTGTTCTATAATGGCAGATACTTGGACCAACACAGAGGGAAAGAAAATGATCAGTTTCTTGGTCTCGTGCCCT
CGCGGTGTCTACTTCCACTCCTCCATTGAGGCCACTCATATAATAGAAGATGCGTCAAGCCTTTTCAAGTGTCTAGACAA
ACTAGTTGATGACATTGGCGAGGAAAACGTGGTGCAGGTTATTACACAGAACACTGCTATCTGCAGAAATGCTGGAAAAT
TACTAGAAGAAAAGAGAAAGAATATGTATTGGACTCCTTGTGCAATGCATTGCACAGAACTGGTTCTTGAAGACATCTCA
AAGCTTGAATTTGTCTCCGACTGCTTAGAGAAAGCACAAAGAATCACAAGATTCATTTACAATCAAACATGGCTACTTAA
TCTCATGAAGAACGAATTCACACGGGGACAAGATCTTCTTAGACCAGCGGTCATGCGCTACGCTTCCGGTTTCACCACTC
TTCAAAGTCTTATGGACCACAAGGCCAGTCTTAGAGGTCTGTTTCAATCTAACGGCTGGATTTTGTCACAGACCGCTGCC
AAGTCTGAAGAGGGAAGAGAAGTGGAAATGATGGTGTCTAGTGTTGCGTTTTGGAAGAAGGTTCAGTATGTTTTGAAATC
GGTTGATCCCGTGATGCAGGTGATTCGCATGATCGATGATGGTGGCGAGAGAGTATCTTTGCCATATGCTTACGGTTACA
TGTGCTGTGCGAAAATGGCTATCAAGTCTATTCATAGCGATGATGGGAGGAAATACTTACCATTATGGCGTGTGATAGAT
TACCATTGGAACCCATTGTTTCATCATCCTCTCTATGTGGCTGCATATTTCTTCAACCCGGCATATAGATATCGTCCTGA
TTTTATGTCGGTAGGCATGATTATCAGTTATTTTATGCAATCACTTAAACTTTCTGTAATATCCTTACGTTTTGCTGTTA
ATGTGAAAAATATCTGCAGCAGTCTGAGGTCGTGCGCGGAGTGA