Details for Capsella Locus Carubv10013082m

Position : scaf_3 ( 5`- 5776755 .. 5781070 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013082m

Protein [Map View]
MRNLNFNGESTSESYTPTAQTSAGMPSSEGFFSPEFRGDFGAGLLDLHAMDDTELLSEHVITEPFEPSPFMPSVNKEFED
DFNLPANRQQRQQTDAEPLGSLPKSEKENNSVAKIKVVVRKRPLNKKETARKEEDVVTVSDNSLTVHEPKLKVDLTAYVE
RHEFCFDAVLDEDVSNDEVYRATIEPIIPIIFQRTKATCFAYGQTGSGKTFTMKPLPIRAVEDLMRLLRQPVYSNQRFKL
WLSYFEIYGGKLFDLLSERKKLCMREDGRQQVCIVGLQEYEVSDVQIVKDFIEKGNAERSTGSTGANEESSRSHAILQLV
VKKHVEVKDTRRRNNDGNELPGKVVGKISFIDLAGSERGADTTDNDRQTRIEGAEINKSLLALKECIRALDNDQLHIPFR
GSKLTEVLRDSFVGNSRTVMISCISPNAGSCEHTLNTLRYADRVKSLSKSGNSKKDQTANLMPPLNKDTLLVSNDVEDVF
EPPQELNVQETRRRVVEKDSNTTSGIDFRQPTNYREESGIPSISMDKGRSETNSSFGGSTSQRNHLSSIPQETSDREEKV
KKVSPPRGKGLREEKPDRPQNWSKRDVSSSDIPTLTNFRQSTNETASRQYETDTSLDENIDALLEEEEALIAAHRKEIED
TMEIVREEMKLLAEVDQPGSMIENYVTQLSFVLSRKAAGLVSLQARLARFQHRLKEQEILSRKRVPR*

DNA
ATGAGAAATCTCAATTTTAATGGGGAATCGACTTCTGAATCATATACGCCAACTGCTCAGACATCAGCAGGTATGCCGTC
TTCGGAAGGATTTTTTTCACCTGAGTTCAGAGGTGATTTTGGAGCTGGATTATTGGATCTTCATGCAATGGATGATACAG
AGCTTCTATCTGAGCATGTGATTACTGAACCCTTTGAGCCGTCACCTTTCATGCCTAGTGTTAATAAAGAATTTGAAGAC
GATTTTAATTTGCCAGCTAATCGTCAACAACGGCAACAGACAGATGCTGAACCTTTAGGTTCATTGCCTAAGAGTGAAAA
AGAAAATAACAGTGTAGCCAAGATTAAAGTAGTGGTAAGGAAAAGACCTCTAAATAAGAAAGAAACAGCTAGAAAGGAGG
AGGATGTCGTGACGGTATCTGATAATTCTTTGACTGTCCATGAACCCAAGCTGAAGGTCGATTTAACTGCTTATGTAGAA
AGGCATGAGTTCTGCTTTGATGCTGTTCTAGATGAGGATGTTTCAAATGATGAGGTGTATCGAGCCACAATTGAGCCGAT
AATTCCCATTATATTCCAGAGAACTAAAGCTACATGCTTTGCATATGGTCAAACAGGTAGTGGCAAGACATTCACAATGA
AACCACTACCCATACGAGCAGTTGAAGATCTTATGAGGTTGTTGCGTCAACCAGTATACAGCAATCAGAGGTTTAAATTG
TGGCTCAGCTATTTTGAAATATATGGTGGAAAGCTGTTCGATCTGCTCAGTGAGAGAAAGAAACTTTGCATGCGAGAAGA
TGGCAGACAGCAAGTTTGCATTGTTGGCCTGCAAGAATATGAAGTTTCAGATGTACAAATTGTAAAGGATTTTATTGAGA
AAGGAAATGCTGAAAGAAGCACAGGGTCTACTGGAGCAAATGAGGAATCTTCTAGATCACATGCTATCCTACAGCTTGTT
GTAAAAAAGCATGTTGAGGTAAAAGACACTAGACGGAGGAATAATGATGGTAATGAATTGCCTGGGAAAGTTGTGGGAAA
GATTTCGTTCATTGACCTTGCTGGCAGTGAAAGAGGTGCAGACACCACAGACAATGACCGCCAGACAAGGATTGAAGGCG
CAGAAATCAACAAGAGTCTCTTGGCTCTTAAGGAATGTATACGTGCACTGGACAATGATCAGCTACATATACCATTTCGT
GGAAGCAAACTAACTGAGGTGCTCCGTGACTCATTCGTTGGAAACTCAAGGACAGTGATGATTTCTTGCATCTCCCCAAA
TGCAGGATCGTGTGAACATACCCTCAATACTCTAAGATATGCTGATCGGGTCAAAAGTCTATCCAAAAGTGGAAATAGCA
AGAAAGATCAAACTGCCAATTTAATGCCTCCGCTTAATAAGGATACTTTGTTGGTCTCAAATGATGTGGAAGATGTCTTC
GAGCCCCCACAGGAATTGAATGTACAGGAAACCAGGAGGAGGGTGGTCGAGAAGGACAGCAACACTACATCAGGTATTGA
CTTCAGACAGCCTACTAATTATCGAGAGGAAAGTGGAATACCATCAATCTCAATGGACAAGGGAAGATCAGAGACGAACA
GCTCTTTCGGTGGCTCCACTAGCCAGAGGAACCACTTGTCTTCAATTCCCCAAGAAACTTCAGACCGTGAAGAGAAAGTG
AAGAAAGTGTCACCACCTCGTGGAAAAGGGTTGCGGGAAGAAAAACCAGACAGACCACAAAATTGGTCTAAAAGAGATGT
CAGTTCATCGGATATCCCTACCTTGACAAACTTTAGACAGAGCACAAATGAAACCGCTTCGAGGCAATATGAAACTGACA
CTTCTCTTGATGAAAACATTGATGCACTGCTTGAGGAAGAAGAAGCCCTCATTGCAGCACACAGAAAAGAAATCGAGGAT
ACAATGGAGATTGTTCGCGAGGAAATGAAACTTTTAGCGGAGGTGGACCAACCAGGAAGCATGATAGAAAACTATGTGAC
GCAACTGAGCTTTGTGTTGTCTCGAAAAGCAGCAGGGCTTGTTAGTCTTCAAGCCAGGCTTGCTCGGTTCCAACACCGTC
TCAAGGAGCAAGAAATATTGAGCCGTAAGAGAGTTCCTCGGTAG