Details for Capsella Locus Carubv10013068m

Position : scaf_3 ( 5`- 5559958 .. 5563430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013068m

Protein [Map View]
MGFLIGGSCFVPSVPLHSRFLPSPSSSTSPSQFGLLCSSNVAKFKRRRPTSASLNREDGHAYDAASAKRRAFLLVGISVL
PFLKLRAPALADERGNEIKTSKVDQETEVAVVSEGTSPSTFLSLLNGLGIFSAGVLGALYALARQDTKAAEETIESLKNQ
LKDSERALILKEKDFEARLQHEQEERKKELEKAKEEQLSLTNQLNAAKDVVAGLGRELSSEKRLCEELKVQIDSLQNSLS
KAVEDKKALETELKKKVDLVEKLQDRINLLSLELKDNEEKIQRISAQLVEKELELEHLNSAYTQISRDLAKANLEIKQQK
EELTRTQSELDSKNSAIEKLNTRITTLVAEKESYIQKLNDLSKDYSALKLSSEARAAADAENIRGKEQEIQQLNGKLDHA
LDEVNKSKDEVANLTEEYEDSKRMFDIEQTTVKNLRHELEGTKKTLQASRDRVSDLEKMLDESRALGSKLESELAIVHAE
WNEAKEKYERKLDAEKQKNETLASELAVEKDLLKRAKDELEGLTHELRESSVKNQSLQKELVETYKKVETTNKELEGEKK
TVLSLNKEVKGMEKQILMDREARKSLETDLEEAVKSLDEMNKNTSKLSRELEKVNTQVSSLEDEKEVLQRSLEEAKNVSK
EAKENVEDAHILVMSLGKEREVLEKKVKKLEEDLGSAKGEILRMRSQPKSVKAVNSTDDKEKSDDTVTVKKVVRRRKSST
SS*

DNA
ATGGGTTTCCTCATTGGAGGCTCTTGCTTCGTCCCTTCTGTTCCTCTCCACTCCAGGTTTCTTCCATCTCCTTCTTCTTC
TACTTCTCCATCTCAGTTTGGGCTTCTGTGTTCGAGCAATGTCGCCAAGTTTAAGCGTCGCCGACCAACATCGGCTTCTT
TAAATCGGGAAGATGGGCACGCGTACGACGCTGCTTCAGCCAAAAGGAGGGCTTTTCTTCTTGTGGGTATCTCCGTTCTT
CCGTTTCTGAAGCTTCGAGCACCGGCTTTGGCTGATGAAAGAGGCAACGAGATAAAGACATCAAAGGTTGACCAAGAAAC
TGAGGTTGCAGTAGTAAGTGAAGGAACATCCCCCAGTACTTTTTTGTCTCTCCTGAATGGTCTTGGAATTTTTAGTGCTG
GAGTTCTTGGTGCACTCTATGCACTTGCTCGCCAAGATACAAAAGCTGCTGAAGAAACCATTGAATCTCTAAAGAACCAG
TTGAAAGACAGCGAAAGAGCATTAATTTTGAAGGAGAAAGACTTTGAAGCAAGACTGCAGCATGAGCAGGAAGAGCGGAA
AAAGGAACTAGAAAAGGCAAAAGAGGAACAATTGTCATTGACCAACCAGTTAAATGCTGCGAAGGATGTGGTGGCAGGCT
TAGGCCGGGAGCTAAGTAGCGAGAAGAGACTCTGTGAGGAGCTTAAAGTTCAAATCGATAGTCTGCAAAATAGTCTGTCA
AAGGCTGTTGAAGACAAAAAGGCCCTTGAAACAGAGCTGAAAAAAAAGGTTGATTTGGTTGAGAAGCTACAAGATCGAAT
CAACTTGCTTAGCTTGGAGCTGAAAGATAATGAAGAAAAAATTCAACGTATTAGTGCACAGCTGGTAGAAAAGGAATTAG
AATTGGAGCATCTCAACTCTGCTTACACTCAAATTAGCCGAGATCTTGCCAAAGCGAATTTAGAAATCAAACAGCAGAAG
GAAGAACTCACAAGAACTCAGAGTGAATTGGACTCGAAGAATTCTGCAATAGAGAAGTTAAACACCAGAATAACAACTTT
AGTGGCTGAGAAAGAAAGTTATATCCAGAAGCTTAATGACCTTTCAAAAGATTATAGTGCTTTGAAATTGTCTTCTGAGG
CGCGAGCAGCTGCAGATGCAGAAAACATCAGAGGGAAAGAGCAGGAGATTCAGCAGCTAAATGGAAAGCTGGATCATGCG
CTAGATGAGGTAAATAAAAGTAAAGACGAAGTTGCTAACTTAACTGAGGAGTATGAAGACTCGAAGAGAATGTTCGACAT
AGAACAGACTACTGTAAAAAATTTGAGACATGAACTTGAAGGAACAAAGAAAACACTGCAGGCATCTAGAGATCGAGTCT
CTGACCTAGAAAAGATGCTTGATGAGTCAAGAGCTTTGGGTTCAAAGTTAGAATCAGAGCTTGCTATAGTTCACGCAGAG
TGGAATGAAGCGAAGGAAAAATATGAAAGGAAACTCGATGCAGAAAAACAAAAAAATGAGACTTTGGCTAGCGAACTTGC
AGTGGAGAAAGACCTTCTGAAGAGAGCTAAAGACGAGCTTGAGGGATTAACCCATGAACTCAGAGAGTCTTCTGTCAAGA
ACCAGAGCCTTCAGAAGGAACTAGTGGAGACTTACAAGAAAGTTGAAACCACTAACAAAGAATTGGAAGGGGAGAAAAAG
ACTGTTTTGTCGTTGAACAAAGAGGTGAAAGGAATGGAAAAGCAGATCTTGATGGACAGAGAGGCTAGGAAATCCCTTGA
AACCGACCTCGAAGAAGCAGTAAAGTCTTTGGATGAGATGAACAAGAATACATCGAAATTGTCACGAGAGCTTGAGAAGG
TAAATACCCAAGTCTCGAGCTTGGAGGACGAGAAAGAAGTGCTTCAAAGATCACTAGAAGAGGCAAAGAATGTATCAAAA
GAAGCAAAGGAAAACGTAGAAGATGCACATATCCTCGTGATGAGTCTAGGAAAAGAGAGGGAAGTGCTAGAGAAGAAAGT
GAAGAAGCTCGAGGAGGACTTGGGCTCTGCAAAGGGTGAGATACTGCGCATGAGGAGCCAACCGAAGTCTGTAAAAGCTG
TGAATAGTACAGATGACAAAGAGAAAAGTGATGACACAGTTACTGTGAAGAAAGTTGTCAGGAGGAGAAAGAGCAGTACC
AGTTCTTGA