Details for Capsella Locus Carubv10013066m

Position : scaf_3 ( 5`- 2197288 .. 2201533 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013066m

Protein [Map View]
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGKFSGGFDISGFGEIQKGT
RKEPKVGYISIDIITDLLEAARKPSVAAIDGLALGGGLELSMACHARISTPGAQLGLPELQLGVIPGFGGTQRLPRLVGL
TKALEMILTSKPVRAEEGHSLGLIDAVVPSAELLTTARRWALDIVERRKPWISSLLKTDKLPPLGEAREILKFARGQTRK
QAPNMKHPLMCLDALEMGIVSGPRAGLEKEAEVGSQVISLDTTKGLIHVFFSQRGTAKVPGVTDGGLVPRKIKKVAIIGG
GLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVI
ENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVERGADPYLIDMAISKFGMPMGPFRLCDLVGFGVAIATATQFIENFPE
RTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGGNVDPKLVKLSEKEIIEMTFFPVVNEAC
RVFAEGIAVKAADLDIAAIMGMGFPPYRGGIMFWADSMGSKYIYSRLDEWSKTYGDFFKPCAFLAERASKGAPLSAPVEQ
ARSRL*

DNA
ATGGATTCACGAACCAAGGGTAAGACGGTGATGGAAGTTGGTGGCGATGGCGTTGCCGTCATAACACTCATCAATCCTCC
TGTCAATTCTCTATCTTTTGACGTGCTGTACAACCTCAAAAGTAATTACGAGGAGGCCTTGAGCAGGAATGATGTTAAAG
CTATTGTTATTACTGGTGCAAAGGGAAAGTTCTCTGGTGGCTTTGATATTTCTGGTTTTGGTGAAATCCAGAAGGGGACT
AGGAAAGAGCCAAAGGTTGGATACATATCAATCGACATCATCACCGACTTGCTTGAAGCTGCTAGGAAGCCCTCTGTTGC
TGCCATTGATGGGCTTGCCTTGGGAGGAGGGTTAGAACTTTCTATGGCTTGCCATGCAAGGATATCAACTCCTGGTGCAC
AGTTAGGTCTGCCCGAGCTGCAACTCGGTGTTATTCCTGGATTTGGAGGAACGCAACGTCTTCCTCGTCTTGTTGGTCTC
ACAAAAGCCCTTGAAATGATTTTGACATCTAAGCCAGTTAGAGCTGAAGAAGGTCATTCATTGGGCCTTATTGATGCTGT
AGTGCCATCTGCCGAGTTATTAACCACTGCTCGTCGTTGGGCCCTTGACATAGTTGAGAGGAGAAAACCATGGATTTCTA
GTCTCTTAAAGACTGACAAGTTACCTCCTCTTGGAGAGGCAAGGGAGATACTGAAGTTTGCCAGAGGACAGACACGCAAG
CAAGCCCCCAATATGAAACACCCCTTAATGTGCCTTGACGCTCTTGAAATGGGTATTGTTTCTGGTCCAAGGGCTGGCTT
AGAAAAGGAGGCTGAAGTCGGCTCTCAAGTGATCAGCCTTGATACCACCAAAGGCTTGATCCATGTATTCTTTTCCCAGC
GAGGAACTGCAAAGGTTCCTGGAGTTACTGATGGTGGGTTGGTGCCTAGGAAGATTAAAAAGGTAGCCATAATTGGTGGC
GGGTTAATGGGATCTGGAATTGCCACTGCATTAATCCTAAGTAACTATCCAGTGATTCTCAAGGAGGTAAATGAGAAGTT
CCTGGAGGCGGGAATTGGCAGAGTTAAAGCTAATCTTCAGAGTCGTGTAAGGAAAGGAAGCATGTCTAAGGAAAAGTTTG
AGAAAACCATGTCTCTCCTTAAGGGTTCTCTTGATTATGAGAGCTTTAGGGATGTGGACATGGTCATTGAGGCTGTTATT
GAAAATATATCTTTGAAGCAACAAATTTTTGCTGATTTGGAGAAGTACTGTCCTCAGCATTGTATTCTCGCTAGCAACAC
ATCTACCATTGACTTGAACAAAATTGGGGAGCGGACCAAGTCTCAGGATCGAATTGTTGGAGCACATTTTTTCAGTCCAG
CACACGTCATGCCACTACTTGAAATAGTTCGGACTAATCATACCTCTGCCCAAGTAATTGTTGACCTGTTAGATGTTGGT
AAGAAGATTAAGAAAACACCAGTCGTGGTGGGAAACTGCACAGGTTTTGCAGTGAATAGGATGTTCTTCCCTTACACACA
GGCAGCTATGTTCCTTGTTGAGCGTGGAGCAGATCCATATCTAATTGACATGGCAATCAGCAAGTTTGGAATGCCAATGG
GTCCTTTCAGATTGTGTGACTTGGTTGGATTTGGTGTGGCGATTGCAACCGCAACACAATTCATTGAGAACTTCCCAGAA
CGGACATACAAATCAATGATTATCCCACTTATGCAAGAGGACAAGAGAGCTGGTGAAGCGACTCGTAAAGGTTTCTATTT
GTATGATGATAAGCGCAAGGCTAAACCTGATCCTGAGTTAAAGAAATATATCGAAAAGGCAAGGAGCATATCTGGAGGAA
ATGTTGACCCTAAGTTGGTGAAACTGTCAGAGAAGGAAATAATTGAAATGACATTTTTCCCAGTAGTAAACGAGGCGTGT
AGGGTTTTTGCTGAAGGTATTGCAGTCAAAGCTGCAGACCTTGACATTGCTGCCATAATGGGAATGGGTTTTCCACCTTA
CAGAGGAGGAATCATGTTCTGGGCTGATTCCATGGGATCGAAATACATTTACTCGAGGCTAGATGAGTGGTCAAAGACTT
ACGGTGATTTCTTCAAGCCTTGTGCTTTTTTGGCTGAAAGGGCATCTAAAGGAGCTCCTCTGAGCGCTCCCGTGGAGCAA
GCCAGATCGCGGTTGTAA