Details for Capsella Locus Carubv10013065m

Position : scaf_3 ( 5`- 13393361 .. 13398649 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013065m

Protein [Map View]
MCLTHFLVELQTVRDFFRQKPLVTDDGVTLRSETTTAYLIDGESGRLIHVYKSTHSSEDTKMINALVKPTSNVDLVKLPL
LIRRTDSKLEHFGNTTGKLVWNLTVSHFRAAFLCDPVYNSGYELGPRVQTGIFMPLPCGSQIDVPGPELVIRVHHDHSMK
VKMLPSPSQNHFESENNIMPSGIALESRKLQEQHGQKYTYVFGKVFEWSPVKFLVPLVLLGVVVSIFIKRFSSRGSEFSS
KSGPSKKKKNRKSGKDTNGQKDRQSVPRGQDQFELIEGGQMLLGFNSFPSGATDGRKIGKLFVSSKEIAKGSNGTVVFDG
IYEGRPVAVKRLVRSHHEVAFKEIQNLIASDQHSNIIRWYGVEYDQDFVYLSLERCTCSLDDLIKSYLEFSMTQILRNNE
SAEAVPTYKIQLDSLEGAIKGNSFWKFGGHPSPLMLKLMRDIVSGVVHLHELGIVHRDLKPQNVLISKEMTAKLSDMGIS
KRMSRDMSSLGQLATGSGSSGWQAPEQLVQGRQTRAVDMFSLGCVIFYTITGCKHPFGDDLERDVNIVKNKVDLFLVEHV
PEASDLISRLLNPNPDLRPSASEVLVHPMFWDSETRLSFLRDASDRVELENREVDSEILRAMESTAPVAIGGKWDEKLEP
VFITNIGRYRRYKYDSIRDLLRVIRNKLNHYRELPPEIQELVGTVPEGFDEYFAIRFPKLLIEVYRVISLHCKEEEVFRK
YFKSNII*

DNA
ATGTGTTTGACACATTTTCTTGTTGAATTGCAGACAGTTCGGGACTTTTTTAGACAGAAGCCACTTGTAACGGATGATGG
TGTGACTCTTAGGTCAGAAACAACTACTGCCTATTTGATTGATGGTGAATCAGGGAGGCTAATCCATGTTTACAAATCAA
CCCATTCTTCTGAAGATACTAAAATGATTAATGCTCTGGTGAAGCCAACTAGCAATGTAGATCTTGTGAAGCTACCTCTT
CTTATCAGGCGAACAGATTCCAAACTAGAGCATTTTGGTAATACCACTGGAAAGCTTGTCTGGAATCTTACGGTTTCTCA
CTTCAGAGCTGCTTTTCTATGTGATCCAGTTTACAATTCAGGCTATGAGCTCGGTCCTAGAGTCCAAACTGGAATCTTTA
TGCCATTGCCATGTGGATCACAAATTGACGTTCCTGGCCCTGAACTTGTTATTAGAGTGCATCATGATCACTCAATGAAA
GTGAAAATGCTACCCTCCCCCTCCCAAAATCACTTCGAAAGTGAAAACAACATAATGCCTTCTGGAATAGCCCTAGAATC
AAGGAAGTTACAAGAGCAACATGGGCAAAAATATACCTATGTGTTTGGAAAAGTTTTTGAATGGTCGCCCGTGAAGTTCT
TGGTTCCTTTAGTGCTTCTGGGTGTTGTTGTCTCTATTTTCATTAAAAGGTTTTCGTCGAGGGGGAGTGAATTTAGTTCG
AAATCTGGACCTTCCAAAAAGAAAAAGAATCGTAAATCAGGGAAGGATACAAATGGGCAGAAAGATAGGCAGTCAGTTCC
TCGTGGCCAGGATCAGTTCGAGCTCATTGAAGGTGGTCAAATGTTACTAGGCTTCAATAGCTTTCCAAGTGGTGCAACTG
ATGGGCGAAAGATTGGTAAGTTGTTTGTGTCAAGTAAAGAAATTGCAAAGGGAAGTAACGGAACAGTGGTGTTTGATGGT
ATTTACGAAGGTCGGCCTGTAGCTGTAAAACGCCTTGTTCGATCTCATCATGAGGTTGCTTTCAAAGAGATTCAAAACCT
CATTGCATCAGACCAGCACTCAAACATCATTCGGTGGTATGGTGTGGAGTATGATCAAGATTTTGTATACCTTTCTCTAG
AGCGTTGCACTTGCAGTTTGGATGATCTAATCAAATCCTATTTAGAGTTTTCTATGACACAAATATTGAGAAACAACGAA
TCTGCTGAAGCGGTACCTACATATAAGATCCAACTGGATTCATTGGAGGGAGCTATCAAAGGAAACAGTTTTTGGAAATT
TGGAGGCCACCCGTCACCTCTCATGCTTAAACTAATGAGGGATATAGTGAGTGGGGTTGTCCACTTACACGAATTGGGGA
TAGTTCATCGAGATCTGAAGCCACAAAATGTGTTAATTAGTAAAGAGATGACTGCAAAGCTTTCTGATATGGGCATTAGC
AAACGTATGTCTAGAGATATGTCATCGTTGGGTCAACTAGCCACCGGTTCTGGTAGTTCGGGTTGGCAAGCACCAGAGCA
GCTAGTACAAGGTCGTCAAACTCGTGCAGTGGACATGTTCAGTTTAGGTTGTGTCATCTTTTACACTATAACTGGTTGTA
AGCATCCATTTGGAGATGATCTTGAACGTGATGTCAATATTGTGAAGAACAAAGTTGACCTATTTCTAGTAGAACACGTT
CCAGAAGCTTCAGACCTCATATCCCGTTTGTTGAACCCAAACCCTGATTTACGTCCCAGTGCATCCGAAGTGCTGGTCCA
TCCTATGTTTTGGGACTCAGAGACGAGACTGTCGTTTCTTCGGGATGCTAGTGACCGAGTTGAGCTTGAAAATAGAGAAG
TTGATTCTGAAATCTTGAGAGCAATGGAGAGTACAGCTCCAGTGGCTATAGGAGGCAAATGGGACGAAAAACTAGAACCT
GTTTTCATCACAAACATCGGTCGCTACAGACGTTACAAATATGATAGCATTCGTGACTTGTTACGAGTTATTAGGAACAA
ACTGAACCATTATCGAGAACTTCCTCCAGAAATCCAGGAACTCGTCGGAACAGTTCCAGAAGGATTCGATGAGTACTTTG
CCATACGGTTCCCGAAATTGTTGATTGAAGTGTACAGAGTCATCTCTCTGCACTGCAAGGAAGAAGAAGTATTCAGAAAG
TACTTCAAAAGCAACATCATCTAA