Details for Capsella Locus Carubv10013064m

Position : scaf_3 ( 5`- 3228347 .. 3235812 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013064m

Protein [Map View]
MALVQRPHSYLHRYFRLMASRPRLFSHSLYPSLHRHSSSLTSSTPRIKFQLANVFSQRLVQRNAVSPKSFMSSTMESAQE
SSTSKDYSSEHIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGFASKIDVVLHSDDSVSISDNGRGIP
TDLHPATRKSALETVLTVLHAGGKFGGKSSGYSVSGGLHGVGLSVVNALSEALEVIVRRDGMEFQQKYSRGKPITTLTCH
VLPPDSRETQGTCIRFWPDKEVFTTAIQFDHNTIAGRIRELAFLNPKVTISLKKEDDDPERDLYSEYIYAGGLTEYVSWL
NTDKKPLHDVLGFRKEINGATVDVALQWCSDAYSDTMLGYANSIRTVDGGTHIEGVKASLTRTLNSLAKKLKVIKEKDIS
LSGEHVREGLTCIVSVKVPNPEFEGQTKTRLGNPEVRKIVDQSVQEYLTEYLELHPDVLENIISKSLNAYKAALAAKRAR
ELVRSKSVLKSSSLPGKLADCSSTDPAESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERKDEAAMYKNEEIQN
LILGLGLGVKGEDFNKENLRYHKIIILTDADVDGAHIRTLLLTFFFRYQRALFDAGCIYVGVPPLFKVERGKQAHYCYDD
AALKKITASFPGNASYNIQRFKGLGEMMPAQLWETTMNPDTRILKQLVIEDAAETNMVFSSLMGARVDVRKELIKSAATR
MNLENLDI*

DNA
ATGGCTCTTGTTCAGAGACCACACTCTTATCTTCACCGTTATTTTCGTCTCATGGCTTCTCGTCCCCGTCTGTTCTCTCA
CTCTCTATATCCTTCACTTCACCGTCACTCCTCATCTCTCACCTCTTCAACACCCAGGATAAAGTTTCAGTTAGCTAATG
TTTTTAGTCAAAGACTTGTACAAAGAAATGCGGTCTCACCTAAGAGTTTTATGTCATCGACCATGGAGTCTGCCCAAGAG
AGCTCTACCTCTAAGGATTATAGTTCGGAGCACATCCAAGTGTTGGAAGGCTTAGACCCTGTCAGGAAAAGACCTGGGAT
GTATATTGGTAGCACCGGATCTCGTGGTTTGCACCACCTGGTTTATGAGATCCTTGACAACGCAATTGATGAGGCCCAAG
CTGGTTTTGCTTCAAAGATCGATGTTGTTTTACATTCAGATGATTCAGTCAGCATTTCAGACAATGGACGTGGGATACCT
ACAGATTTGCATCCTGCAACGAGAAAATCTGCTTTGGAGACTGTCCTTACGGTCTTACATGCAGGGGGTAAGTTTGGTGG
CAAGAGCAGTGGGTACAGCGTGTCTGGTGGATTACATGGTGTAGGTTTATCGGTTGTGAATGCTTTGTCTGAGGCATTGG
AGGTTATTGTTCGCAGAGATGGGATGGAGTTTCAACAGAAATATTCTCGTGGAAAGCCCATAACAACACTTACATGTCAT
GTCCTCCCACCTGATTCAAGGGAGACTCAAGGGACATGCATACGGTTTTGGCCTGACAAAGAAGTATTCACAACTGCAAT
TCAATTCGACCATAACACCATTGCGGGTCGAATTAGGGAGCTTGCTTTTCTAAATCCAAAGGTTACAATCTCTCTAAAAA
AGGAGGATGATGATCCAGAAAGGGACTTGTATAGTGAATATATCTATGCTGGAGGGTTAACTGAATATGTTAGCTGGTTA
AATACTGATAAGAAACCGCTTCATGATGTGCTGGGTTTCCGGAAAGAGATAAATGGTGCTACCGTTGATGTTGCACTTCA
GTGGTGCTCAGATGCCTATTCTGACACGATGCTGGGATACGCGAATAGCATTCGGACCGTTGATGGTGGGACACATATAG
AAGGTGTGAAGGCTTCATTAACAAGAACTCTAAATTCCCTTGCAAAAAAATTGAAGGTTATTAAGGAAAAGGATATTAGC
TTAAGTGGGGAACATGTTAGGGAGGGATTGACCTGCATTGTCTCTGTCAAGGTTCCTAATCCTGAGTTTGAAGGTCAAAC
AAAGACAAGACTAGGAAATCCAGAGGTGAGAAAAATTGTTGACCAATCAGTCCAGGAGTACCTCACAGAGTACTTGGAAT
TGCATCCGGATGTACTTGAAAACATTATTTCCAAATCCTTGAATGCGTACAAGGCTGCTCTGGCTGCCAAGCGGGCTAGG
GAGTTGGTGAGATCAAAAAGCGTTTTGAAATCATCCTCACTTCCTGGGAAACTTGCAGATTGCTCATCTACAGATCCTGC
TGAATCTGAGATTTTCATTGTCGAAGGAGATTCTGCTGGTGGCAGCGCGAAACAGGGTCGTGACAGGCGTTTCCAGGCGA
TTCTTCCTTTGAGAGGTAAAATTTTGAATATTGAGAGAAAGGATGAAGCCGCCATGTATAAGAACGAAGAAATTCAAAAC
CTAATACTTGGCCTTGGTCTTGGAGTCAAGGGAGAAGATTTTAACAAGGAGAATCTACGTTACCATAAAATTATTATATT
AACAGATGCAGATGTTGATGGTGCACATATCCGGACTCTTCTGTTGACCTTTTTCTTCAGATATCAGAGAGCCTTGTTTG
ACGCGGGGTGCATATATGTTGGTGTTCCACCTCTTTTCAAGGTTGAGAGGGGGAAACAGGCGCACTATTGCTACGATGAT
GCAGCTCTTAAAAAAATTACCGCTTCGTTCCCTGGAAACGCATCCTACAACATTCAGAGGTTCAAAGGTTTGGGTGAGAT
GATGCCTGCGCAGCTATGGGAAACAACAATGAATCCAGATACAAGGATATTGAAGCAACTAGTTATTGAGGACGCAGCAG
AAACGAACATGGTCTTTTCATCTCTGATGGGTGCTCGGGTCGATGTCCGGAAGGAACTCATCAAAAGCGCTGCTACAAGG
ATGAATCTGGAGAATCTCGACATATAA