Details for Capsella Locus Carubv10013060m

Position : scaf_3 ( 5`- 8598820 .. 8601263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013060m

Protein [Map View]
MSSSKTLIRTLIQNPTRIKSKSQAKQLHAQFIRTQSLSHTSASIVISIYTNLKLLHEALLLFKTLESPPVLAWKSVIRCF
TDQSLFSRALASFVEMRASGRCPDHNVFPSVLKSCTMMMDLRLGESVHGCIVRLGMDCDLYTGNALMNMYAKLLGMGSKI
SVGKVFDEMPQRMSRLGSCCVATESVEPVMNCDEDLEAETCTMPLGIDSVRKVFEVIPRKDVVSYNTIIAGYAQSGMYED
ALRLVREMGTTDIKPDAFTLSSVLPIFSEYVDVIKGKEIHGYAIRKGIDADVYIGSSLVDMYAKSARIEDSERVFSHLAR
RDSISWNSLVAGYVQNGRYNEALRLFRQMVTTKVRPGPVAFSSVIPACAHLATLRLGKQLHGYVLRGGFGSNIFISSSLV
DMYSKCGNINAARKIFDRMNVHDEVSWTAIIMGYALHGHGHEAVSLFEEMKEQGVKPNKVAFVAVLTACSHVGLVDEAWG
YFNSMTKVYGLNQELEHYAAVADLLGRAGKLEEAYDFISKMRVEPTGSVWSTLLSSCSVHKNLELAEKVSEKIFSIDSEN
MGAYVLMCNMYASNGRWKEMAKLRLKMRKKGLRKKPACSWIELKNKTHGFVSGDRSHPNMDRINEFLKPVMEQMEKEGYV
ADTSGVLHDVDEEHKRELLFGHSERLAVAFGIINTEPGTTIRVTKNIRICRDCHVAIKFISKITEREIIVRDNSRFHHFN
RGSCSCLDYW*

DNA
ATGAGTTCATCAAAAACCCTAATCAGAACCCTGATTCAGAATCCAACTCGCATCAAATCCAAATCTCAAGCCAAGCAGCT
TCACGCACAGTTCATCAGAACCCAATCTCTCTCCCACACATCAGCTTCCATCGTAATATCAATCTACACGAACCTCAAAC
TCTTGCATGAAGCTTTGCTTCTTTTCAAAACGCTTGAGTCTCCTCCTGTTCTAGCATGGAAGTCAGTAATCAGATGCTTC
ACCGACCAGTCTCTATTCTCACGCGCGTTAGCTTCGTTCGTGGAAATGAGAGCCTCGGGTCGATGCCCAGATCACAATGT
GTTCCCTTCTGTGCTGAAATCGTGTACGATGATGATGGATTTGAGATTGGGTGAGTCTGTTCATGGGTGTATCGTTAGGC
TTGGCATGGATTGTGATTTGTATACAGGGAATGCGTTGATGAATATGTATGCTAAGCTTCTTGGTATGGGTTCAAAGATA
AGTGTAGGTAAAGTGTTCGATGAAATGCCTCAAAGAATGTCCAGATTAGGTTCATGTTGTGTTGCCACTGAATCCGTTGA
ACCTGTTATGAACTGTGATGAAGATTTAGAGGCTGAAACTTGCACTATGCCTTTAGGAATAGATAGTGTGAGGAAAGTTT
TTGAAGTGATCCCTAGAAAGGATGTTGTGTCCTACAATACTATCATTGCAGGGTATGCACAGAGTGGAATGTATGAAGAT
GCTTTAAGACTGGTCAGGGAGATGGGAACTACTGATATAAAGCCTGATGCTTTCACTTTGTCCAGTGTGCTTCCTATATT
TTCTGAGTATGTGGATGTTATTAAGGGAAAAGAGATTCATGGGTATGCGATTAGAAAGGGAATTGATGCTGATGTATATA
TTGGGAGTAGTTTAGTTGATATGTATGCAAAAAGTGCTCGGATTGAAGACTCCGAAAGAGTGTTTTCTCATTTGGCTCGT
CGGGATAGTATCTCATGGAACTCGCTTGTAGCTGGATATGTACAGAATGGTAGATACAACGAGGCTTTGAGATTATTTAG
GCAAATGGTGACCACAAAGGTTAGGCCAGGACCTGTGGCATTCTCAAGTGTGATTCCTGCTTGTGCGCACCTAGCTACTT
TGCGCCTCGGGAAACAACTTCACGGATATGTATTAAGAGGTGGCTTTGGGAGTAACATATTTATATCTAGTTCACTTGTC
GATATGTACTCGAAATGTGGGAATATTAATGCTGCTAGGAAGATTTTTGACAGGATGAATGTACATGATGAAGTATCATG
GACAGCTATCATAATGGGGTACGCGTTACATGGTCATGGACATGAAGCTGTCTCTTTGTTTGAGGAGATGAAAGAGCAAG
GAGTTAAACCAAATAAAGTGGCATTTGTTGCTGTACTAACTGCTTGTAGTCATGTGGGGTTGGTAGATGAGGCATGGGGA
TATTTTAACAGCATGACTAAGGTTTATGGTTTAAACCAGGAGTTAGAACATTATGCTGCTGTAGCGGATCTTCTAGGCCG
TGCAGGGAAACTGGAAGAAGCATATGATTTCATTTCAAAGATGCGTGTTGAACCGACAGGTAGTGTCTGGTCTACCTTGT
TGTCTTCTTGCAGTGTCCACAAGAATCTTGAGTTAGCTGAGAAGGTATCAGAGAAGATATTTTCTATTGATTCAGAAAAC
ATGGGAGCTTACGTTCTAATGTGCAATATGTATGCCTCTAATGGGAGATGGAAAGAAATGGCGAAACTGAGATTGAAAAT
GAGGAAAAAAGGATTGAGGAAAAAGCCAGCTTGTAGTTGGATCGAACTGAAAAACAAGACTCATGGGTTTGTATCAGGAG
ATAGATCGCATCCGAATATGGACAGAATCAACGAGTTTCTTAAACCTGTAATGGAACAGATGGAGAAAGAAGGGTATGTT
GCAGACACAAGCGGCGTGCTTCACGATGTAGACGAGGAGCATAAGAGAGAGCTTTTGTTTGGACACAGCGAGAGATTGGC
TGTTGCCTTTGGTATCATCAACACAGAACCTGGCACAACAATAAGGGTGACTAAGAACATAAGGATCTGCAGGGATTGTC
ATGTCGCGATCAAGTTTATCTCGAAGATCACAGAGAGAGAGATTATTGTAAGGGATAATAGCAGATTCCACCATTTCAAC
CGTGGGAGTTGTTCTTGTTTAGACTATTGGTGA