Details for Capsella Locus Carubv10013058m

Position : scaf_3 ( 5`- 9287070 .. 9290156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013058m

Protein [Map View]
MLEGKLRSGVYRSFIMCDDPRDVVECGAIKKQSKGRSSNIRCDRPLKTKERSEMVVAPPRKSTEDDAPRSSMQLLRVSKG
IQKLNVAIDSLSKGFSFEAASSRPEDIAKDLLRGALDLEESLAMLSSIQEDDVKQKPRVCKDGGRTDLRFQRSMSDRFGE
RIEKRVMNEENVASKDCYEELRKVIRESFLRQNLLSQTKTIGTNKTRVVRSGFASSSGAASSSTSSSQSSLVSGSTQSSA
SSDVPRRAPSLIARLMGLDVSTQEPSKSVMNHVDKPDIVKLSSEREEQRKQNKKENLETVRCNSTREAVIQSLPEEIPSE
NPSTIVLIRPMRVVQPEMKEKPGNKQTVVPKKPRMQGEVHPRMINQRKDHQAKGSNKMKLPLSMTKKDKEPKEIVRKVEQ
NEGKVIKIMSPTNAKAVTRDRKPMESNKTNKKLVVKKEDNAEGKDRHRLHNRGLKPTSNPAAQKKLNDSSDLSRNKSQRS
SRLRSSSSSGEQKSSSREKKVGEANRPNAKKKLRQQDNDLSSENNSCSSQDTRGSLNQVSTEETTSSELYNQGHCDNGEV
SSCAGIVQHSHEPETSQISLGTFLSSSSDFIKYAEDLFNLNTNTKRSQRDSIVITDQRLALDFAKEVARRRSLLLTEPMC
RQRSCVHIDELLMEVCDGFESLRSYKDTFSGQDSFVKESIHMVLEKDLKSKKTEMTSGVWDLGWRSEFQIDETYQAVVDL
EKLILSGLIQEIIT*

DNA
ATGCTTGAAGGGAAACTGAGATCAGGAGTTTATAGATCATTTATAATGTGTGATGATCCAAGAGATGTTGTTGAATGTGG
TGCTATTAAGAAACAGAGTAAAGGTCGTAGTAGTAACATTAGATGTGACCGTCCTTTGAAAACGAAGGAGAGATCCGAAA
TGGTTGTGGCTCCTCCTAGGAAGAGTACTGAGGATGATGCTCCTCGTTCCTCTATGCAGCTTTTGAGAGTGTCTAAAGGG
ATTCAGAAACTTAATGTTGCTATTGATTCATTGTCTAAAGGGTTTAGCTTTGAGGCTGCGTCGTCTAGGCCTGAGGATAT
AGCGAAAGATTTGTTGAGAGGAGCGCTTGATTTGGAAGAGTCTTTAGCTATGTTGAGTAGTATCCAAGAAGATGATGTTA
AGCAGAAACCGAGGGTTTGTAAAGACGGTGGTAGAACCGATTTGCGGTTTCAGAGATCGATGTCTGATAGATTCGGAGAG
CGGATTGAGAAACGGGTGATGAATGAGGAGAATGTAGCATCTAAAGATTGTTATGAAGAGTTGAGGAAAGTGATTAGAGA
AAGCTTTCTTAGGCAGAATCTTTTGTCACAAACAAAAACTATAGGGACTAATAAGACTCGTGTTGTTAGAAGTGGTTTTG
CTTCCTCTTCTGGTGCTGCGTCTTCGTCAACGAGCTCGAGCCAATCTTCTTTGGTCTCTGGCTCTACACAGTCCTCTGCT
TCGTCTGATGTTCCACGGAGAGCTCCAAGTTTGATTGCTAGGCTTATGGGTTTGGATGTATCAACTCAAGAACCGAGCAA
AAGCGTCATGAATCATGTCGATAAGCCGGATATCGTTAAGCTGTCATCAGAAAGAGAAGAGCAGAGGAAGCAGAATAAGA
AGGAGAATCTTGAAACTGTGAGATGTAACTCTACAAGAGAAGCTGTTATACAATCTTTGCCTGAAGAGATTCCAAGTGAG
AATCCTTCAACTATAGTGCTCATCAGACCAATGCGTGTTGTACAACCGGAAATGAAAGAAAAGCCGGGAAACAAACAAAC
GGTTGTACCTAAGAAACCAAGAATGCAAGGAGAGGTTCATCCAAGAATGATTAACCAAAGAAAAGATCATCAAGCCAAGG
GAAGCAACAAAATGAAACTACCATTAAGTATGACCAAGAAAGATAAAGAACCGAAAGAAATAGTGCGGAAAGTAGAACAG
AATGAAGGCAAAGTGATCAAGATAATGTCTCCGACCAATGCCAAAGCTGTAACACGAGATCGAAAGCCGATGGAAAGCAA
CAAAACCAACAAAAAGCTTGTTGTCAAGAAAGAGGATAATGCTGAAGGTAAAGACAGACATAGACTTCATAATCGAGGTC
TTAAACCAACCAGCAACCCTGCGGCTCAAAAGAAACTGAACGATTCTTCAGACTTATCAAGAAACAAGAGTCAACGGTCC
AGCAGGTTAAGGTCAAGCTCTAGTAGTGGTGAGCAGAAGAGTAGTAGTCGGGAAAAGAAGGTCGGTGAGGCTAATAGACC
AAATGCCAAGAAGAAACTTCGTCAACAAGACAACGACCTAAGTTCAGAGAATAATTCATGCTCTTCACAGGACACGCGTG
GATCACTTAACCAAGTTTCTACAGAAGAAACCACTTCTTCAGAGTTATACAATCAAGGCCATTGTGACAATGGAGAAGTT
TCATCTTGTGCTGGCATAGTTCAGCATTCTCATGAGCCAGAAACCTCTCAAATCTCACTTGGAACATTCCTATCTAGCTC
CTCAGATTTCATCAAGTACGCAGAGGATCTCTTTAACTTAAACACAAACACGAAACGAAGCCAAAGAGATAGCATTGTGA
TCACAGACCAAAGACTTGCGCTAGACTTTGCCAAAGAAGTAGCCAGACGTAGAAGCCTTCTTCTAACAGAACCAATGTGT
CGGCAACGAAGCTGTGTGCACATTGATGAGTTGTTAATGGAAGTCTGTGATGGGTTTGAGTCTCTGAGAAGTTACAAAGA
CACGTTTTCAGGACAGGACAGTTTCGTTAAAGAGAGCATTCACATGGTGTTGGAGAAGGATCTAAAGAGTAAGAAGACAG
AGATGACAAGTGGAGTATGGGATTTGGGTTGGAGAAGTGAGTTTCAGATCGATGAAACTTATCAAGCTGTAGTTGACTTA
GAGAAACTTATCTTATCAGGTTTAATTCAAGAAATTATCACTTAA