Details for Capsella Locus Carubv10013055m

Position : scaf_3 ( 5`- 4571609 .. 4574376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013055m

Protein [Map View]
MDTPSLDGTSTRRTKRRNVSRKNYDENAMDELIEKQLGGNLKKKFRTKQDLEKETETEALIALSVGFPIDELLEEEIQAG
VVRELGGKEQNDYIVVRNHIVARWRSNVRMWLLKDQIRETVSSDCEHLISAAYDFLLFNGYINFGVSPLFAPYIPEEGTE
GSVIVVGAGLAGLSAARQLLSFGFKVLVIEGRSRPGGRVYTQKMGDKDRFAAVELGGSVITGLHANPLGVLARQLSIPLH
KVRDNCPLYNSEGALVDKVADSNVEFGFNKLLDKVTEVREMMEGAANKISLGEVLETLRVLYGVAKDSEERKLFDWHLAN
LEYANAGCLSNLSAAYWDQDDPYEMGGDHCFLAGGNWRLINALAEGLPIIYGKSVDTIKYGDGGVEVISGSQIFQADMIL
CTVPLGVLKKRSIKFEPELPRRKQAAIDRLGFGLLNKVAMLFPSVFWGDELDTFGCVSESSINRGEFFLFYAYHTVSGGP
ALVALVAGEAAQRFECTEPSVLLHRVLKKLRGIYGPKGVVVPDPIQTVCTRWGSDPLSYGSYSHVRVGSSGVDYDILAES
VRNRLFFAGEATTRQHPATMHGAYLSGLREASRILHVANYFRSYLKKPVQRYSGVNIVVLEDLFKRPDIATGKLSFVFNP
LTDDPISIGLVRVSFENLEDDPTNRLQLYTILSREQANKLQELGENSNESKLAYLISTFGLKLMGVNSVLDTGGALISVI
ANARKGRSRPQVVAG*

DNA
ATGGATACTCCGTCGTTGGATGGAACGTCTACTAGGAGAACGAAGAGGAGAAATGTAAGTAGGAAGAACTACGATGAGAA
TGCGATGGATGAATTGATTGAGAAGCAATTGGGTGGGAATTTGAAGAAAAAGTTCAGGACGAAGCAAGATTTGGAGAAAG
AAACCGAGACGGAGGCTCTGATAGCCTTGTCCGTAGGTTTCCCAATCGACGAATTGCTTGAAGAAGAGATTCAAGCTGGG
GTTGTAAGAGAATTGGGCGGGAAAGAGCAGAATGATTACATTGTTGTTCGGAATCATATAGTAGCTCGGTGGAGGAGTAA
TGTCAGGATGTGGCTACTCAAAGATCAGATTAGAGAAACTGTGAGTAGTGACTGTGAGCATTTGATTTCAGCTGCTTATG
ATTTTCTCTTGTTTAATGGATACATCAATTTTGGGGTTTCTCCATTGTTTGCACCTTACATTCCTGAGGAGGGTACGGAG
GGATCAGTCATTGTCGTTGGTGCTGGGCTTGCTGGTTTGTCTGCTGCACGGCAGCTCTTATCATTTGGGTTCAAGGTTCT
TGTTATAGAAGGTAGGAGTCGTCCTGGTGGACGAGTGTACACTCAGAAGATGGGAGATAAGGATAGATTTGCAGCCGTTG
AACTCGGGGGCAGTGTTATCACGGGTCTACATGCGAACCCACTTGGAGTTCTTGCTAGACAGCTTTCTATACCTCTACAC
AAGGTTAGAGACAATTGTCCTTTGTATAATTCAGAAGGAGCACTTGTCGATAAGGTGGCTGACTCCAATGTTGAGTTTGG
TTTCAATAAACTGCTTGACAAAGTCACCGAAGTGAGGGAGATGATGGAAGGGGCAGCTAACAAGATCTCTTTGGGTGAAG
TCTTGGAGACTCTCAGGGTACTGTATGGTGTAGCTAAAGATTCAGAGGAAAGAAAACTTTTTGACTGGCATCTTGCTAAC
TTGGAATATGCTAACGCTGGGTGTCTTTCGAATCTTTCAGCTGCTTATTGGGATCAAGATGATCCTTACGAAATGGGTGG
GGATCACTGTTTTCTTGCCGGTGGAAACTGGAGACTGATAAATGCATTAGCTGAAGGCTTACCCATAATCTATGGGAAAA
GTGTTGATACTATTAAATATGGAGATGGAGGAGTTGAAGTCATTTCTGGCAGCCAGATATTTCAAGCTGACATGATTCTT
TGCACTGTGCCGCTCGGGGTCTTGAAGAAAAGATCTATCAAGTTTGAGCCAGAGTTACCTAGAAGAAAACAAGCAGCCAT
TGACAGGTTAGGGTTTGGGCTTCTGAACAAAGTTGCCATGCTTTTCCCGTCTGTATTCTGGGGTGACGAGTTAGACACGT
TTGGATGCGTCAGTGAGAGTAGCATCAACCGAGGAGAGTTCTTTCTGTTCTATGCCTACCATACAGTTTCTGGTGGCCCT
GCCTTGGTTGCCTTAGTTGCTGGAGAAGCTGCTCAAAGATTTGAGTGCACAGAACCATCTGTTTTACTTCACCGTGTTTT
AAAAAAACTCAGAGGCATATATGGTCCTAAAGGTGTTGTTGTGCCTGACCCAATACAGACGGTTTGCACTAGATGGGGAA
GTGATCCTTTGTCATATGGGTCATATTCTCATGTAAGGGTTGGTTCATCTGGCGTGGACTATGACATCCTAGCTGAAAGT
GTGAGAAACCGACTATTCTTTGCTGGTGAGGCCACAACAAGGCAACATCCAGCCACAATGCACGGTGCCTACTTAAGTGG
TTTAAGAGAAGCCTCGCGGATTCTACATGTTGCGAACTATTTTCGCAGTTATCTGAAGAAACCTGTCCAGAGATACAGTG
GAGTTAACATCGTTGTTCTTGAAGATCTGTTCAAAAGACCCGATATTGCAACTGGGAAGTTGTCATTTGTCTTCAACCCA
TTAACCGACGATCCAATATCAATTGGATTAGTCAGAGTTAGTTTTGAAAACTTGGAAGACGACCCAACCAATCGCCTTCA
GCTTTACACTATTCTTTCGCGGGAGCAAGCTAACAAGCTTCAGGAATTGGGCGAAAATAGTAATGAAAGCAAACTGGCCT
ATCTGATCAGTACTTTTGGATTAAAGCTAATGGGTGTCAACTCAGTACTAGACACAGGTGGTGCGTTGATCAGTGTCATA
GCTAATGCACGCAAGGGCCGGAGCAGACCCCAAGTTGTTGCAGGGTAA