Details for Capsella Locus Carubv10013054m

Position : scaf_3 ( 5`- 6917683 .. 6921409 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013054m

Protein [Map View]
MNGAACKRVTRSSASGSKQINVDCGREVNPTVDNASEQGNASVPLKPSVAGSNMPNDANEDGHLHHEIRENGNGKEVQKP
SPQTEKKRSNAKTKFSGSHRELVLGLPCSGQFDIQLSKSSKSSKRLGGGGERKVLFSSHKSAQKSKEAAGPSLVPANNKP
VGRPKKRNKTMKKGQVREDDEYTRIKKKLRYFLNRISYEQNLIDAYSLEGWKGSSLEKLRPEKELERATQEILRRKLKIR
DLFQHLDTLCAEGSLPESLFDSDGEISSEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQYCLEPPLRKEDIPPDDEGWL
CPGCDCKDDSLDLLNDSLGTKLSVSDSWEKIFPEAAALLSGGDQNLNCDLPSDDSDDEEYNPDGLNDNENEEDNSEESEN
EDGSSDESDFTSASDEMIESFKEGKDIMKDIMALPSDDSEDDDYDPEAPTRDEDEIQESSNSDCTSDSEDIETSFKGNES
NQQEKVTPLEDPGRKKFQLPCEAISESDAVLDDGLAGVPKRRNVERLDYKKLYDDEYENVPSSSSDDDDWDTTAKMGKEN
SESEDEGDTAPLKQSSSAEDHTSKKPRRKSKRADKNDTLKVREQGPGENGCSGPSGEKSSSSAYKQTDPKAQRLYISFQE
NQYPDKATKESLAKELRMTITQVSNWFKYKRYSTNSKAVVSEEDVEKSKTGKEGECGRSVAGSSKQTTMETASVAGNKSV
ALESTKPGSRKRRRR*

DNA
ATGAATGGAGCAGCTTGTAAACGGGTTACTAGGAGTAGTGCATCTGGTTCGAAGCAGATAAATGTAGATTGCGGAAGAGA
GGTTAATCCAACTGTTGACAATGCATCTGAACAAGGCAATGCCTCCGTACCTCTAAAACCATCAGTGGCAGGGAGTAACA
TGCCAAATGATGCAAACGAAGATGGGCATTTGCATCATGAAATTAGGGAAAATGGAAATGGGAAGGAAGTACAGAAACCA
TCTCCTCAAACCGAGAAGAAGAGATCTAATGCCAAAACCAAATTTTCAGGGTCTCATCGCGAACTTGTCCTCGGTCTTCC
TTGCAGTGGACAATTTGATATCCAGCTGTCCAAGTCATCTAAGAGTTCAAAGAGGTTAGGAGGAGGTGGTGAAAGGAAGG
TGTTGTTTTCAAGCCACAAGAGTGCTCAGAAATCTAAAGAAGCTGCTGGACCATCTTTGGTTCCTGCTAATAACAAACCT
GTAGGTAGACCAAAGAAAAGAAATAAGACTATGAAGAAAGGACAAGTTAGAGAAGATGATGAGTACACAAGAATCAAAAA
GAAACTTCGATACTTTCTAAACCGGATCAGCTATGAGCAAAACCTTATTGATGCCTATTCTTTAGAAGGATGGAAAGGTT
CAAGCCTGGAAAAGCTAAGGCCAGAGAAAGAGCTTGAACGAGCCACACAGGAAATTCTGCGGCGCAAGCTTAAAATTAGA
GATCTTTTTCAGCACCTGGACACACTCTGTGCTGAAGGAAGCCTTCCAGAGTCTTTATTTGATTCTGATGGAGAGATTTC
GAGCGAGGATATCTTCTGTGCAAAATGTGGCTCTAAGGACTTGTCTGTTGATAATGATATCATACTATGTGATGGGTTTT
GCGACCGAGGCTTTCACCAATACTGTCTTGAACCACCTTTGCGAAAAGAAGATATTCCTCCTGATGATGAGGGTTGGCTA
TGCCCCGGTTGTGATTGCAAAGATGACAGCTTGGACTTGCTTAATGATTCTCTAGGGACAAAACTTTCGGTCAGCGACAG
TTGGGAGAAAATATTTCCTGAGGCAGCAGCATTATTGTCTGGTGGAGATCAAAATCTGAATTGTGATCTTCCGTCAGATG
ATTCTGATGATGAAGAGTATAATCCAGATGGTTTGAATGATAATGAAAATGAAGAAGATAACAGTGAAGAGTCTGAGAAC
GAAGATGGTAGTTCTGATGAATCTGATTTCACTTCTGCATCTGACGAAATGATTGAGTCATTTAAAGAAGGGAAAGATAT
AATGAAAGATATAATGGCCCTTCCATCTGATGATTCTGAGGATGATGACTATGATCCTGAAGCCCCTACTCGTGATGAAG
ATGAAATACAAGAAAGTTCAAATTCTGATTGTACATCAGACTCTGAGGATATTGAAACTTCCTTCAAAGGAAATGAGTCT
AATCAGCAAGAAAAAGTTACACCACTTGAGGATCCTGGCAGAAAGAAATTTCAGCTCCCGTGTGAAGCCATTTCAGAGTC
AGATGCTGTGCTTGATGATGGTCTTGCCGGTGTTCCCAAAAGGAGGAATGTTGAAAGGCTGGATTACAAAAAGTTGTATG
ATGACGAATATGAGAATGTTCCATCTTCCTCAAGTGATGATGATGATTGGGATACAACTGCAAAAATGGGAAAAGAAAAT
TCTGAGTCAGAAGATGAAGGGGACACTGCGCCTCTGAAACAATCTTCAAGTGCTGAAGATCATACGTCTAAGAAACCTAG
AAGGAAGTCGAAAAGGGCAGATAAAAATGATACTTTAAAAGTGCGAGAACAAGGTCCTGGAGAAAATGGTTGTTCTGGAC
CTTCTGGTGAAAAAAGCAGCTCTTCAGCTTATAAACAGACAGATCCAAAAGCTCAGAGATTATACATATCCTTTCAAGAG
AATCAATATCCAGACAAAGCCACAAAGGAGAGCTTAGCGAAGGAGCTACGAATGACAATTACGCAAGTTAGTAACTGGTT
TAAGTATAAGCGCTATTCGACAAACAGCAAAGCTGTGGTTTCAGAGGAAGATGTTGAGAAGTCAAAAACAGGCAAGGAAG
GTGAATGTGGGAGATCTGTTGCTGGAAGTAGCAAACAAACTACTATGGAAACCGCGTCAGTTGCAGGGAACAAGAGTGTA
GCACTGGAATCAACCAAACCTGGATCAAGGAAAAGAAGGAGAAGGTAG