Details for Capsella Locus Carubv10013047m

Position : scaf_3 ( 5`- 797932 .. 801107 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013047m

Protein [Map View]
MESIGDDDELRSKASSHRRRISFTILLLLLISFSSTRVSGSIDESGRRVIEARTGQDLIWVVQLSDLHFSVHHPERAIDF
KNIVGPALSLINPSLVLITGDLTDGKSKDMLTMKLNEDEWLEYESVMQDVVKRSGLNKSIFYDLRGNHDNFGVPAVSSSA
DFFSKYSINGQMGRKENVNTITVETSERKHLFVGVDTTMHIGLRGPTNLFGHPTDELLSSLDSHLSQWDNQSAKPVAKIS
FGHFPLSFTAQSHSQKSLKDVFLKHSISAYLCGHLHSKFGKNLKRHHYSGGISLSDNDLFQLNMRQSSAESTSNCSFGAL
PAAEFWEWEMGDWRKSRAMRIMAIDRGHVSYVDLDFKSKSQKTIILPTFPLDSRFMSTSFARHKYECQHMISSSYDTIRA
IVFSHSLVVEVVARVYDSSPGFDNLVMEAPMRKHGGDTSSGATFFSLPWNYKAFEDPLPDRFWLQIEVTDIRGRLTLSEM
RPFSINGLSSKVSWTWHEFRVMGCQWAALYYPILWSALYSLLLVFLVPKCIIIVFKKQYTLKKFIAKKGPITLVLWILQD
LCRMPVVWFGYMAYLFYLIFFPWFSGEVFTDSGNRTYMTIMGWVVTSSGADRKHEYVGQPDVMVLVIPHVVFVVVPSVLV
VCCLVAEREMYKDHIRTISGKKEDDHDWGRKKRSQRRSLLFSNRRLFRKSILLASLALYWKHFKNCWALARAYEMNVVHY
PGYSLVVPLLLLYVICKTHKVP*

DNA
ATGGAATCGATCGGCGACGACGATGAGCTCAGAAGCAAAGCATCTTCTCATCGGAGAAGAATCTCGTTTACGATTCTTCT
TCTTCTCCTTATCTCGTTTAGTAGTACGAGAGTCTCTGGTTCGATTGACGAATCTGGAAGAAGAGTGATTGAAGCGAGAA
CTGGGCAAGACTTGATTTGGGTTGTTCAGCTGTCCGATCTCCATTTCAGTGTTCATCATCCCGAAAGAGCCATTGATTTC
AAAAACATCGTGGGTCCTGCTCTGTCTCTTATCAACCCTTCTCTCGTCCTAATCACCGGTGATCTCACAGATGGGAAAAG
CAAAGACATGTTAACAATGAAGCTAAATGAAGATGAGTGGTTAGAATACGAGAGTGTGATGCAAGATGTTGTCAAAAGAA
GTGGACTGAATAAGAGCATATTCTATGATCTTAGGGGTAACCATGACAACTTTGGTGTTCCGGCTGTTAGTTCATCTGCT
GATTTCTTCTCCAAGTATAGCATCAACGGACAGATGGGAAGGAAAGAAAATGTCAACACCATAACTGTTGAGACTAGCGA
ACGTAAACATCTGTTTGTTGGTGTTGACACCACAATGCATATTGGTTTGCGTGGCCCGACAAATCTCTTTGGGCATCCAA
CTGATGAGCTTTTGAGCTCACTTGACTCACACCTATCGCAATGGGATAACCAATCAGCAAAACCTGTGGCAAAAATATCA
TTTGGGCATTTCCCGTTGTCATTCACAGCGCAGTCACATTCTCAAAAGAGCCTTAAAGATGTTTTTCTGAAGCACTCCAT
CTCAGCATATTTGTGTGGCCATCTACACTCAAAGTTTGGCAAGAATCTGAAAAGACATCATTACTCTGGTGGTATCAGTT
TATCAGATAATGACTTGTTTCAGCTGAATATGAGGCAGAGTAGTGCTGAAAGTACTTCCAACTGCTCCTTTGGAGCCTTG
CCAGCTGCAGAGTTCTGGGAATGGGAGATGGGTGACTGGAGAAAAAGCAGGGCAATGCGGATCATGGCCATTGATAGGGG
TCATGTTTCATATGTTGATCTTGACTTCAAGTCAAAATCCCAGAAGACTATCATATTACCGACCTTTCCATTAGATTCAC
GTTTTATGTCAACATCCTTTGCACGTCACAAATATGAATGCCAACATATGATCTCATCATCCTATGACACAATAAGAGCC
ATTGTGTTTTCTCATTCCCTGGTTGTGGAAGTCGTAGCAAGAGTTTATGACTCGAGCCCTGGATTTGACAATCTGGTCAT
GGAAGCTCCAATGAGAAAACATGGAGGTGACACTTCTTCCGGGGCAACATTCTTTTCCCTTCCATGGAATTATAAAGCCT
TTGAAGATCCCTTACCTGATAGATTTTGGCTGCAAATAGAAGTTACTGACATCAGAGGCAGATTAACTTTATCAGAAATG
CGACCATTTTCTATCAATGGTCTAAGCTCTAAAGTTTCATGGACATGGCATGAGTTTCGTGTCATGGGCTGCCAATGGGC
GGCATTATATTACCCGATTCTTTGGTCTGCTCTATATAGTTTGTTACTCGTATTTCTTGTCCCCAAATGCATTATCATTG
TTTTCAAGAAGCAGTACACTCTGAAGAAGTTCATTGCGAAGAAGGGACCAATTACACTTGTACTGTGGATTCTCCAAGAC
CTCTGCAGAATGCCTGTAGTTTGGTTCGGTTACATGGCATACTTGTTCTATCTCATATTCTTCCCTTGGTTCTCTGGTGA
AGTGTTTACTGATTCCGGAAACAGAACATACATGACTATTATGGGATGGGTGGTCACAAGCTCAGGTGCAGATAGGAAAC
ATGAATACGTTGGACAACCTGACGTAATGGTTCTGGTGATACCACATGTGGTCTTTGTTGTTGTCCCCAGTGTCTTGGTT
GTGTGTTGTCTGGTTGCTGAGAGAGAAATGTACAAAGATCACATTCGAACCATCTCTGGCAAGAAAGAGGATGACCATGA
CTGGGGAAGGAAGAAGAGATCACAACGCCGGTCGCTGCTGTTCTCTAACAGAAGACTGTTTCGAAAATCGATCTTGCTGG
CTTCATTGGCTCTATATTGGAAGCATTTCAAGAACTGCTGGGCTCTAGCTAGAGCTTATGAGATGAACGTGGTTCATTAT
CCAGGTTACAGCCTTGTAGTTCCATTGTTGCTACTATATGTTATCTGCAAAACCCATAAAGTTCCATGA