Details for Capsella Locus Carubv10013040m

Position : scaf_3 ( 5`- 1454215 .. 1459329 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013040m

Protein [Map View]
MHRVGSAGSNGGSVRTRKEKKLTYVLNDTNDSKHCAGINCLDVLKSSVSNDQNYLFTGSRDGTLKRWAFDEDATFCSATF
ESHVDWVNDATLAGESTLVSCSSDTTVKTWDGLSDGVCTRTLRQHSDYVTCLAVAAKNSNVVASGGLGGEVFIWDIEAAL
SPVTKPNDANEDSSSSNGANGPVTSLRTVGSSNNISVQSSPSHGYTPTIAKGHKESVYALAMNDTGSMLVSGGTEKVLRV
WDPRTGSKSMKLRGHTDNVRVLLLDSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHTDSVWALACTPSFSHVYSGGRDQ
CLYLTDLATRESVLLCTKEHPIQQLALQDNSIWVATTDSSVERWPAEVQSPQKIFQRGGSFLAGNLSFNRARVSLEGLNP
PPAYKEPSIIVPGTHPIVQHEILNNKRQILSKDAAGAVKLWDITRGVVVQDYGKISFEEKKEELFEMVSIPSWFTVDTRL
GCLSVHLETPQCFSAEMYSADLKVSGRPEDDKINLARETLKGLLGHWLAKKKHKPKPQVLSSGDTLSVKDTKKNQSASKN
EDSSAASDPVYPPFEFSSVSPPSIITEGSQGGPWRKKITEFTGTEDEKDFPLWCLDAVLNNRLPPRENTKLSFFLHPCEG
STVQVVTLGKLSAPRILRVHKVTNYVVEKMVLDNPLDSLAIDAASVSGGQPQPLFAGNGLLQSGLKSWQKLRPSIEILCN
NQVLSPDMSLATVRAYIWKKPEDLILNYRVAIAR*

DNA
ATGCACCGGGTTGGAAGTGCCGGCAGTAATGGCGGGTCTGTCCGCACTCGCAAAGAGAAAAAGCTTACCTATGTATTAAA
TGATACCAACGATTCAAAGCATTGTGCTGGCATAAATTGCTTGGATGTGCTGAAGTCGTCTGTTTCTAATGATCAAAATT
ACCTCTTCACTGGAAGTCGTGATGGCACACTCAAGAGATGGGCATTTGATGAGGATGCTACCTTTTGCTCAGCTACGTTT
GAGTCTCATGTTGACTGGGTGAACGATGCTACTCTGGCTGGTGAAAGTACTCTTGTTTCTTGTTCTTCAGACACTACGGT
CAAGACATGGGACGGCTTATCAGATGGAGTCTGTACGAGGACTCTCCGTCAGCATTCTGACTATGTTACTTGTTTGGCAG
TTGCGGCAAAAAATAGTAATGTTGTTGCATCTGGTGGCCTCGGTGGGGAAGTTTTTATATGGGATATCGAAGCTGCTTTG
TCACCAGTTACAAAACCTAATGATGCTAACGAAGATAGTTCTTCTTCAAATGGTGCAAATGGTCCTGTTACAAGTTTAAG
AACTGTTGGTTCAAGCAACAATATCTCTGTGCAGTCATCTCCATCTCATGGGTACACACCAACAATTGCCAAAGGCCACA
AGGAGTCTGTGTATGCTTTGGCGATGAATGATACTGGGTCGATGCTCGTCTCTGGTGGAACAGAGAAGGTTTTACGTGTC
TGGGACCCTAGAACTGGTTCAAAGAGTATGAAGCTGAGGGGGCATACAGATAATGTGAGAGTGCTTCTTCTGGACTCAAC
TGGCAGGTTTTGCTTGTCTGGGTCCTCTGATTCTATGATAAGACTATGGGATCTGGGTCAGCAGCGATGTCTTCATACCT
ATGCGGTGCATACAGATTCTGTTTGGGCGCTTGCATGCACTCCATCATTTAGTCATGTTTATAGCGGTGGACGAGACCAA
TGTTTATACTTGACCGACTTGGCAACAAGGGAGAGTGTTTTGCTGTGCACTAAGGAACATCCAATTCAGCAATTAGCTTT
GCAAGATAATAGTATTTGGGTTGCAACTACGGACTCCTCTGTAGAGAGATGGCCTGCCGAAGTACAGAGTCCTCAAAAGA
TCTTTCAACGAGGTGGCTCTTTCTTGGCTGGGAATTTGTCTTTTAATAGGGCGAGGGTGTCTTTGGAAGGACTAAATCCA
CCCCCTGCCTACAAGGAGCCGTCAATAATTGTTCCAGGAACTCACCCGATTGTGCAACATGAGATTTTGAATAATAAAAG
GCAAATTTTATCCAAGGATGCAGCTGGCGCAGTGAAACTATGGGATATAACTAGGGGTGTTGTGGTACAGGACTATGGAA
AGATTTCATTTGAAGAGAAGAAAGAAGAACTGTTTGAGATGGTAAGCATTCCATCATGGTTTACTGTGGATACACGACTT
GGATGCTTATCTGTACATTTGGAGACTCCACAATGCTTCTCTGCTGAGATGTATTCAGCAGACCTTAAAGTTTCTGGGAG
ACCTGAAGATGATAAGATTAATCTAGCTCGTGAAACACTGAAAGGCCTGCTGGGTCACTGGCTGGCTAAGAAGAAGCACA
AACCAAAACCCCAAGTTCTTTCCTCTGGAGATACATTATCTGTAAAAGATACCAAAAAAAATCAAAGTGCATCAAAAAAT
GAAGACAGTAGTGCTGCTAGTGATCCGGTGTATCCTCCATTCGAGTTTTCTTCCGTCTCCCCTCCTTCCATCATAACCGA
GGGCTCTCAAGGAGGACCATGGAGGAAGAAGATAACCGAGTTTACTGGAACTGAAGATGAAAAGGATTTCCCATTGTGGT
GCTTGGACGCTGTCTTGAACAATCGCCTTCCACCTAGAGAAAATACAAAATTAAGCTTCTTCCTACATCCATGTGAAGGT
TCAACTGTGCAGGTGGTTACACTAGGGAAACTTAGTGCACCCCGGATCTTAAGAGTTCACAAGGTTACCAATTACGTTGT
GGAAAAGATGGTTCTTGACAATCCGTTGGATAGTCTAGCTATTGATGCAGCAAGTGTTTCGGGAGGACAACCTCAGCCAC
TGTTTGCAGGAAATGGATTGCTACAGTCTGGATTAAAGTCTTGGCAGAAACTTAGACCTTCCATTGAAATCTTGTGCAAT
AACCAGGTCTTATCTCCAGATATGAGTTTAGCAACTGTACGAGCATATATATGGAAGAAACCTGAGGATCTAATTCTCAA
CTACAGAGTTGCTATAGCTAGATAA