Details for Capsella Locus Carubv10013023m

Position : scaf_3 ( 5`- 7023480 .. 7028632 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013023m

Protein [Map View]
MSDVTVPKSVTVEEEYDAAIEERWSLYEAYNELHALAQELETPFEAPAVLVVGQQTDGKSALVEALMGFQFNHVGGGTKT
RRPITLHMKYDPQCHFPLCHLGSDDDPSVALPKSLSQIQAYIEAENMRLEQEPCPFSAKEIIVKVQYKYCPNLTIIDTPG
LIAPAPGLKNRALQVQARAVEALVRAKMQHKEFIILCLEDSSDWSIATTRRIVMQVDPELSRTIVVSTKLDTKIPQFSCS
SDVEVFLSPPASALDSSLLGDSPFFTSVPSGRVGYGQDSVYTSNDDFKQAVSLREMEDISSLEKKLGRLLTKQEKNRIGI
SKLRLFLEELLWKRYKESVPLIIPLLGKEYRSTVRKLDTVSKELSSLDEAKLKERGRTFHDLFLTKLSLLLKGTVVAPPD
KFGETLQDERTQGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFLVGAIKCPPITREEIVNACGVEDIHDGTN
YSRTACVIAVAKARETFEPFLHQLGARLLHILKRLLPISVYLLQKEGEYLSGHEVFLKRVASAFNSFVESTEKSCRDKCM
EDLASTTRYVTWSLHNKNRAGLRQFLDSFGGTEQLTTSGNPIGFSLPQDGPGGTVDTKSRSDVKLSHLASNIDSGSSIQT
TEMRLADLLDSTLWNRKLAPSSERIVYALVQQIFQGIREYFLASAELKFNCFLLMPIVDKLPALLREELENAFEDDLDSI
FDITNLRQSLDQKKRSTEIELRRIKRIKEKFRVMNEKLNSHEFAQNPKAPSLQQ*

DNA
ATGTCGGATGTTACGGTGCCAAAATCGGTGACGGTGGAGGAGGAGTACGACGCTGCGATTGAGGAGCGGTGGAGTCTGTA
CGAGGCTTACAATGAGTTACACGCTCTGGCGCAGGAATTGGAGACGCCTTTCGAAGCACCGGCGGTGCTTGTGGTTGGAC
AGCAGACGGACGGTAAGAGTGCGCTTGTTGAAGCTCTCATGGGGTTTCAATTTAACCACGTCGGCGGCGGAACCAAGACT
CGCCGCCCCATTACTCTTCATATGAAGTACGATCCTCAGTGTCACTTCCCGCTTTGTCATCTCGGATCCGATGATGATCC
TTCCGTTGCTCTCCCCAAATCTCTCTCTCAAATCCAGGCGTATATTGAAGCCGAGAACATGAGGCTGGAGCAAGAGCCAT
GCCCATTCTCTGCCAAGGAGATTATTGTGAAAGTGCAGTATAAGTACTGTCCCAACCTTACCATCATTGATACACCTGGA
CTCATAGCTCCTGCACCAGGACTCAAAAACCGAGCACTCCAGGTTCAAGCACGGGCTGTGGAAGCTCTAGTCCGAGCAAA
GATGCAACACAAAGAGTTCATTATTTTATGCCTCGAAGACAGCAGTGACTGGAGTATTGCAACTACTCGAAGGATAGTGA
TGCAAGTTGATCCTGAGCTTTCTAGGACAATTGTTGTTTCCACAAAGCTTGACACCAAAATCCCTCAATTCTCATGTTCA
TCCGACGTGGAAGTCTTCCTCTCACCTCCTGCAAGCGCACTTGACAGCTCCTTATTGGGCGATTCCCCTTTTTTCACGTC
TGTACCTTCCGGAAGAGTCGGCTATGGGCAGGATTCAGTATATACGTCCAATGACGACTTCAAACAGGCTGTGTCACTTA
GAGAAATGGAAGACATTTCATCTTTAGAGAAGAAGTTAGGCCGTTTGCTGACTAAGCAGGAAAAGAATAGAATTGGTATT
AGTAAACTGAGGTTGTTTCTAGAAGAACTACTCTGGAAAAGGTACAAAGAGAGTGTTCCATTGATCATTCCACTTTTAGG
AAAGGAGTACCGCAGTACAGTCAGAAAACTAGATACCGTTAGCAAGGAACTTAGCTCTTTAGATGAAGCAAAACTCAAAG
AGAGAGGCAGGACTTTCCATGATCTCTTCTTAACCAAGTTATCATTGTTATTGAAAGGAACGGTTGTGGCCCCTCCAGAT
AAATTTGGTGAGACATTACAAGATGAAAGGACACAAGGAGGAGCATTTGTTGGTACTGATGGTCTCCAGTTCCCACATAA
GTTAATACCAAATGCAGGGATGCGTCTTTACGGGGGTGCACAGTATCACCGTGCCATGGCTGAGTTCCGTTTTCTAGTAG
GTGCTATTAAATGTCCCCCAATAACACGGGAGGAAATTGTGAATGCATGTGGAGTTGAGGATATTCACGATGGAACGAAC
TATTCCAGAACAGCTTGCGTTATAGCAGTTGCAAAGGCTCGTGAGACGTTTGAACCTTTCCTTCATCAGTTAGGGGCGAG
GCTTCTACACATTCTCAAGAGATTGCTTCCAATTTCTGTATATCTTCTTCAGAAAGAAGGTGAATACTTAAGTGGGCATG
AGGTGTTTCTCAAGCGGGTTGCTTCAGCTTTCAACAGTTTTGTGGAGTCCACAGAAAAATCATGTCGTGACAAATGTATG
GAGGACTTGGCAAGTACCACTCGCTATGTTACATGGTCTCTTCACAACAAGAACCGAGCTGGTCTACGTCAATTCTTGGA
CTCATTTGGCGGAACAGAGCAACTTACTACATCAGGTAATCCCATAGGATTTAGTCTTCCCCAAGATGGACCAGGTGGCA
CAGTAGACACAAAGTCAAGATCAGATGTAAAGCTAAGCCATCTGGCCTCAAACATCGATTCAGGTTCCAGTATCCAGACA
ACAGAAATGCGGTTAGCTGATCTTCTAGATAGCACTCTTTGGAACCGCAAGCTTGCTCCTTCTTCTGAGAGAATTGTCTA
TGCATTGGTTCAACAAATATTCCAGGGCATACGAGAGTACTTTCTAGCCTCTGCTGAGTTAAAGTTCAACTGTTTTCTTC
TAATGCCCATCGTTGATAAGTTACCTGCTCTTCTGCGGGAAGAGTTGGAAAATGCATTTGAAGACGACCTGGATAGTATT
TTTGACATCACAAATCTACGGCAATCACTTGATCAAAAGAAACGGAGTACGGAGATCGAGCTGAGAAGGATAAAGAGGAT
AAAAGAGAAATTCAGAGTGATGAATGAGAAGCTAAACTCTCACGAATTTGCTCAAAATCCAAAGGCGCCATCGTTGCAGC
AGTGA