Details for Capsella Locus Carubv10013021m

Position : scaf_3 ( 5`- 2238726 .. 2242832 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013021m

Protein [Map View]
MLAGAPPPYFHFPARYYNCNLRETVRLFRYGGGGGVVARAAFTRRPLETSSSYDDSTDDGFVIIGAADRENESSPPPSSD
LLTSIPSESGKRNGSRSRGVSASFGRLKAQKVKALVGKVAQKKQHMAHSDEEDEDDAFDDDYSADEGFGSSSILDLMRKK
LAMKAIPRSGKSVEKKEVKKFTKVRESRESRRDLDGFEEDDEDIDDQFTDNERAGSRSSYSKGYAANSRGKGDRLSVARD
LGSFEGGERATDAVSNPRKYTDNERAGSQYSYSTDSAANSRGRDDKRFVAKELRTFQGRDKAYDEVYNPQRFTDNERGGS
HFSYSKGSTGNSRGWGDRRSVVYARDMDDWREQRNKTNATKETGFFSRKTFAEIGCSEDMMKALKEHNFDRPAHIQAMAF
APVIDGKSCIIADQSGSGKTLSYLVPVIQRLREEELQGQSKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVPFRSMV
VTGGFRQRTQLENLEQGVDVLIATPGRFMYLMNEGILGLSNLRCAILDEVDILFGDDEFEAALQSLINSSPVTAQYLFVT
ATLPLEIYNKLVEVFPDCEVVMGPRVHRVSNALEEFLVDCSGDDNAEKTPETAFQNKKTALLQIIEENPVSKTIIFCNKI
ETCRKVENIFKRVDRKERQLHVLPFHAALSQESRLKNMKEFTSSQPEENSLFLVCTDRASRGIDFSGVDHVVLFDFPRDP
SEYVRRVGRTARGARGEGKAFIFVVGKQVALARRIIERNQKGHPVHDVPNAYEFTT*

DNA
ATGTTGGCCGGAGCTCCACCACCGTATTTTCATTTCCCGGCGAGGTATTATAATTGTAATCTACGTGAGACTGTGCGGCT
GTTTCGTTACGGCGGAGGCGGAGGAGTGGTAGCTAGAGCTGCTTTCACTCGGCGGCCACTGGAAACTTCGAGCTCGTACG
ACGATTCCACCGACGACGGATTCGTCATCATCGGTGCGGCGGATAGAGAGAATGAGTCCTCTCCTCCGCCGTCTTCCGAT
TTACTCACTTCGATTCCCTCAGAATCTGGGAAAAGAAACGGTTCGCGTTCGAGAGGTGTATCTGCTAGTTTCGGAAGGCT
AAAGGCCCAGAAAGTGAAAGCACTTGTTGGTAAGGTAGCTCAGAAGAAGCAGCATATGGCTCACAGTGATGAAGAGGATG
AGGATGACGCCTTTGATGACGATTATTCTGCGGATGAAGGGTTTGGTTCATCGTCTATTCTGGATTTGATGAGGAAGAAG
CTGGCTATGAAGGCTATTCCCAGATCAGGTAAGTCTGTTGAGAAAAAGGAGGTTAAAAAATTCACCAAAGTTCGGGAATC
TAGAGAGTCAAGAAGGGATTTAGATGGATTCGAAGAAGATGATGAAGATATTGATGACCAGTTTACAGATAATGAGAGAG
CAGGGTCCCGGAGTTCATATTCAAAAGGTTATGCTGCTAACTCCAGGGGTAAGGGCGATAGGCTTTCGGTTGCTAGAGAT
TTAGGTTCCTTTGAAGGAGGTGAAAGAGCCACTGATGCGGTCTCAAACCCTCGAAAGTATACTGATAATGAGAGAGCAGG
ATCACAGTATTCATATTCAACAGACTCTGCTGCTAACTCCAGGGGTAGAGATGATAAGCGTTTTGTTGCCAAAGAGTTAC
GTACATTCCAGGGACGTGATAAAGCTTATGATGAGGTTTATAATCCTCAACGGTTCACTGATAATGAGAGAGGTGGATCA
CATTTTTCATATTCTAAAGGCTCCACTGGTAACTCTAGAGGTTGGGGTGATAGGCGTTCTGTTGTATATGCAAGAGATAT
GGATGATTGGAGAGAGCAAAGGAATAAAACCAATGCTACTAAGGAGACTGGCTTTTTCAGCCGGAAAACTTTTGCAGAAA
TTGGATGTAGTGAGGATATGATGAAGGCCTTAAAGGAACATAATTTTGATCGGCCAGCACATATTCAGGCTATGGCTTTT
GCACCAGTAATCGATGGAAAGAGTTGTATCATAGCTGATCAAAGTGGATCAGGCAAGACACTGTCATATCTTGTCCCTGT
TATTCAGCGTCTCAGAGAAGAAGAACTTCAAGGACAGAGCAAATCGTCTCCTGGGTGTCCTCGTGTTATTGTTCTGGTAC
CAACTGCAGAGCTGGCTTCCCAGGTTCTTGCTAACTGTAGATCAATATCAAAGTCTGGGGTCCCATTCCGTTCCATGGTA
GTGACGGGTGGCTTCAGACAACGAACCCAGCTAGAAAATTTAGAGCAAGGTGTAGACGTATTGATTGCAACACCAGGGCG
TTTCATGTATTTAATGAACGAAGGAATTTTGGGGTTGTCAAATCTAAGATGTGCCATCTTGGATGAGGTAGATATACTCT
TTGGCGATGATGAGTTTGAGGCAGCCCTGCAAAGTTTGATAAACTCTTCCCCTGTTACTGCACAATATCTATTTGTTACA
GCAACCTTGCCACTTGAGATATACAACAAACTTGTTGAAGTTTTCCCTGATTGTGAAGTTGTAATGGGACCTCGAGTGCA
CCGTGTTAGTAATGCTCTCGAAGAGTTTCTTGTTGACTGTAGTGGAGATGATAATGCAGAGAAAACTCCTGAGACTGCTT
TTCAGAACAAGAAAACCGCTCTTCTTCAGATTATCGAGGAAAACCCTGTTTCCAAAACTATTATCTTCTGCAATAAGATT
GAAACATGTAGGAAAGTTGAAAATATATTTAAACGGGTTGATAGAAAGGAAAGGCAGTTGCACGTCCTACCTTTTCATGC
TGCACTCTCACAAGAATCAAGGCTTAAAAACATGAAAGAATTCACGTCATCTCAGCCCGAAGAAAATTCATTGTTTCTGG
TTTGCACAGATAGAGCCTCCCGTGGGATAGATTTCTCTGGAGTTGATCATGTGGTGCTCTTTGACTTTCCACGTGACCCC
AGTGAATATGTGAGACGTGTAGGAAGAACAGCAAGAGGGGCTAGAGGAGAAGGAAAGGCTTTCATCTTTGTGGTGGGGAA
GCAAGTAGCGTTGGCACGGAGGATAATTGAGCGAAATCAAAAGGGTCACCCAGTTCATGATGTCCCAAACGCTTACGAAT
TCACAACTTAA