Details for Capsella Locus Carubv10013003m

Position : scaf_3 ( 5`- 964018 .. 967591 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013003m

Protein [Map View]
MEKVFCGMPLLLLVLLLASIDGSTQLQSSQSQTLLRLQQLLFYPKVLSSWNNFTDFCNSEPSPSLTVVCYEDSVTQLHII
GDNGTHMLPKSFSINSFVTTLVKLPDVKVLTFVSLGLWGWLPQKINRLSSLEILNVSSNFLFGPIPHQLSSLASLQTLIL
DENMFSGQLPDWIGSLPSLAVLSLRKNVFNGSLPSSLSGLSGLRVLALANNRFNGALPDLSHLTNLQVLDLEGNSFGPLF
PRLSDKLVTIILSKNKFRSAVSAQEVSSLYQLQHLDLSFNTFVGPFPASSMSLPAISYLNISHNKLTGRLSANLSCNSQL
MFVDMSSNLLTGSLPTCLKPSSGTSRDVVYAGNCLATTNENQRPVSFCSNEALAVGILPQRRNKVSKVGIALGITAGIFG
VILLAGALFVVLKRFKAKRPVTKGSPRLIRENASMGYTSKLLSDARYISQTMKLGALGLPAYRTFSLEELEYATNNFESS
AFMGEGSQGQIYRGRLKDGSFVAIRCLKMKKSCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEYV
PNGELRSWISDGHMGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLKITDILLDNNLAAKISSYNLPLLVEGLGKV
GQVGSRSGPKGTLSIKAEDKIDIYEFGVILLELIVGRPLRAKVQVDVLKEQLQASILADDGARRSMVDPTVHRACSDQSL
KTMMEICVRCLLKDPLERPSIEDVLWNLQFSSQVQEGWLQNSNPPSIRSSPSPAAPTLPPPSRLHLTTLESPRDSGCEEH
ER*

DNA
ATGGAGAAAGTCTTTTGTGGCATGCCATTACTGCTTCTGGTTCTGCTTTTAGCTTCCATTGATGGCTCTACACAGCTTCA
GTCATCTCAATCTCAAACCCTCTTGAGGCTACAACAGCTTCTGTTCTATCCCAAAGTATTAAGCAGCTGGAACAACTTTA
CTGATTTCTGCAACTCTGAGCCAAGCCCTTCGCTTACCGTTGTGTGTTACGAAGATAGTGTGACGCAGCTTCACATCATA
GGGGACAACGGAACTCATATGTTACCAAAGAGTTTCTCAATAAACTCATTTGTTACTACTCTTGTTAAGCTCCCTGATGT
TAAAGTTCTCACCTTTGTGTCCCTCGGGTTATGGGGTTGGTTACCTCAGAAAATCAACCGTTTATCCTCTTTGGAGATTC
TCAATGTGAGTTCTAATTTCCTCTTTGGACCAATCCCTCATCAACTCTCCTCGCTTGCTAGTCTTCAGACGCTTATACTC
GATGAGAATATGTTCTCTGGTCAGTTACCAGATTGGATTGGTTCTTTGCCGAGTTTAGCTGTGTTGAGCTTGAGAAAGAA
TGTGTTTAATGGGTCATTGCCTTCTTCACTTAGTGGCTTGTCAGGTCTTAGAGTTCTTGCTTTAGCTAACAACCGCTTTA
ATGGAGCTTTGCCTGATTTAAGCCATTTGACAAACCTTCAAGTGCTTGATCTTGAAGGAAACTCTTTTGGACCGTTGTTT
CCTCGGTTAAGTGACAAGTTGGTTACTATTATACTCAGCAAGAACAAGTTTAGATCTGCAGTTTCAGCTCAAGAAGTGAG
CTCTTTGTATCAGCTGCAACATTTGGATCTTTCCTTCAATACATTCGTCGGTCCATTTCCTGCTTCGTCGATGTCTCTTC
CCGCGATAAGTTACTTGAACATTTCACACAACAAACTCACTGGGCGTCTTTCAGCAAATCTTTCTTGCAACTCACAGCTG
ATGTTTGTCGATATGTCATCAAATCTTCTTACTGGAAGTTTGCCTACTTGCCTTAAACCGAGTTCCGGCACTAGCAGGGA
TGTTGTCTATGCAGGCAACTGTTTGGCTACTACGAATGAAAATCAACGTCCAGTTTCATTTTGTAGCAATGAAGCTCTTG
CTGTTGGAATCCTACCACAGAGGAGGAACAAAGTTTCCAAAGTGGGTATTGCTTTAGGCATAACCGCAGGCATTTTCGGA
GTAATTCTCCTCGCTGGTGCCTTATTTGTGGTTCTTAAGAGATTCAAGGCTAAGAGACCAGTGACGAAAGGTTCCCCAAG
ATTGATCAGAGAGAATGCTTCAATGGGATACACATCAAAGCTACTATCAGATGCAAGGTATATATCTCAAACAATGAAGC
TAGGAGCGCTCGGTCTTCCAGCTTACAGGACATTCTCACTGGAAGAGCTCGAGTATGCAACAAATAACTTTGAATCCTCT
GCTTTCATGGGTGAAGGTTCTCAAGGACAGATATATAGAGGAAGGTTGAAAGATGGATCCTTTGTGGCAATCAGATGTTT
GAAAATGAAGAAAAGTTGCAGCACCCAAAACTTGATGCATCACATTGAGCTCATCGCAAAACTAAGGCACCGTCACTTGG
TAAGTGTGCTCGGCCACTGCTTCGAATGCTACTTAGATGATTCAACGGTCAGCAGAATGTTTTTTGTCTTTGAGTATGTC
CCAAATGGAGAACTCAGGAGCTGGATTTCTGATGGGCATATGGGAAGACTGCTTACTTGGGAACAACGCATAAGCGTAGC
GATAGGTGTAGCAAAAGGGATCCAGTTCTTGCATACTGGTATTGTGCCTGGTGTTTATGATAACAACCTTAAAATAACAG
ACATTTTGCTTGACAATAACCTTGCCGCCAAAATCAGTAGCTATAACCTTCCATTACTTGTGGAAGGTCTTGGAAAGGTG
GGGCAAGTAGGATCTCGAAGCGGTCCCAAAGGCACTCTAAGCATCAAAGCCGAAGATAAAATCGATATCTATGAATTTGG
AGTGATTTTGCTAGAACTTATAGTGGGAAGACCACTGAGAGCAAAGGTTCAAGTCGATGTTCTAAAAGAGCAGTTACAAG
CGAGCATTTTAGCGGATGATGGAGCGCGTAGGAGCATGGTGGATCCAACGGTCCATAGAGCTTGTTCAGATCAATCACTG
AAGACAATGATGGAGATATGTGTAAGGTGTCTCCTTAAAGACCCTTTAGAACGTCCTTCCATTGAAGATGTCCTGTGGAA
TCTTCAGTTTTCTTCTCAAGTTCAAGAAGGTTGGCTACAAAACAGTAATCCTCCCAGCATCCGCAGCTCACCTTCTCCCG
CTGCTCCCACTCTTCCTCCTCCCTCTCGTTTACACCTAACAACACTCGAATCTCCCCGAGATTCAGGATGTGAAGAACAT
GAGAGGTAG