Details for Capsella Locus Carubv10013001m

Position : scaf_3 ( 5`- 665606 .. 669160 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013001m

Protein [Map View]
MASSKINRTGLSETPLGKPSLRVAKLTRLVTKSELNSPSPTTQQSRLSLERSSSNSKPSSTEKRSPKVPTPPEKTQTRAV
KGSDSQPRSIHLKEDLRKANELITLLENEKAKALDELKAAREEAEEASRKLDEALKTQKRSQEVFEIEKFEAVEAGIEAV
QRKEEEWKRELENVKNQHATDSAALLLVNQELEKANQELAAANDAQSKVLSQADDASKMAAIHAEKVDILSSELIRLKAL
LDSTREKETITKNEIATKLGAEIVVLERELEKARSFEAKVKELEMIIEQLNVDLEAAKLAESYAHGFADEWQNKAKELEK
RLEEANMLERSASVSLVTVTKQLEGSNNRLHAMESEITDHKEKIVLLELTVASQKVNLEKTELRLGTAEEELSKMEKEAE
KLKNELETLNEEKNQALKKEQDATSSVQRLLEEKNKILSDLESSKEEEEKSKKAMESLASALHEVSSESRELKEKLQSQG
DQDYETQIEDLKLVIKTTNKKYENMLDEARHEIDVLVNAVEQTKKQFESAMVDWEMREAGLVNHVKEFDEEVSSMGKEMN
RLGNLVKRTKEEADAAWEKESQMRDSLKEVEDEVIYLQETLREAKAETLKIKGKMLDKETEFQSIVHENDELRVKQDDSL
KQIKKLSKLLEEALAKKHTEENSELSESEKDYDLLPKVVEFSEENGHRSAEDESCKVKTFDGMDMKLERKGEKEDSPDNA
TVEELWESCQIEKKEGFHRGKPEQESAKDEEEETNMKDQSEKTSPVNGLTGEDELLKEKEKKKKKTLFGKVGNLLKKKGP
MNQK*

DNA
ATGGCTTCTTCTAAGATTAACAGGACTGGTTTATCTGAAACTCCTTTGGGCAAACCATCTCTAAGAGTGGCTAAACTGAC
TCGGTTAGTGACGAAATCTGAACTTAATTCTCCTTCACCTACTACTCAACAGTCACGCCTTTCCCTCGAGCGCTCTTCTT
CTAACTCAAAGCCTTCTTCTACTGAAAAGAGGTCCCCCAAAGTTCCAACCCCACCAGAGAAAACTCAAACACGGGCTGTG
AAAGGATCAGATTCCCAACCTCGCTCGATTCATCTCAAGGAAGATCTGAGGAAAGCGAATGAACTGATAACATTGCTCGA
GAATGAAAAAGCTAAGGCACTTGATGAACTTAAAGCAGCGCGGGAAGAGGCTGAAGAAGCATCCAGGAAACTAGATGAGG
CTTTAAAAACTCAGAAAAGGTCCCAAGAGGTATTTGAAATTGAGAAATTTGAGGCAGTTGAGGCGGGTATAGAGGCTGTT
CAGAGAAAAGAAGAAGAATGGAAGAGAGAACTCGAGAATGTCAAGAACCAACATGCTACGGATTCAGCTGCTCTTCTTTT
GGTAAACCAGGAGCTGGAGAAGGCCAATCAAGAATTGGCTGCTGCTAATGATGCTCAGAGTAAGGTTTTGAGTCAAGCAG
ATGATGCTAGCAAGATGGCTGCAATTCATGCAGAGAAAGTGGACATCTTGTCCTCGGAGCTAATAAGGTTGAAGGCTTTG
CTTGATTCAACCCGAGAGAAGGAAACCATAACCAAGAATGAGATTGCTACAAAACTAGGAGCGGAAATAGTGGTTTTAGA
AAGAGAGCTTGAGAAAGCGAGAAGTTTTGAAGCAAAGGTCAAGGAATTAGAGATGATCATTGAGCAGCTTAATGTTGACT
TAGAAGCTGCCAAGTTGGCAGAATCTTATGCGCACGGCTTTGCTGACGAGTGGCAGAACAAAGCGAAAGAATTGGAGAAA
CGGTTGGAAGAAGCTAACATGCTGGAGAGATCTGCCTCGGTATCTCTGGTAACTGTGACAAAGCAGTTGGAAGGAAGCAA
TAATAGATTGCACGCCATGGAATCTGAAATTACGGATCATAAGGAGAAAATTGTGTTATTGGAGTTGACCGTTGCTAGCC
AAAAGGTTAATCTTGAGAAAACTGAACTGCGGCTAGGTACTGCAGAGGAAGAGTTATCTAAGATGGAGAAAGAAGCAGAG
AAACTGAAGAATGAGCTTGAAACTCTGAATGAGGAGAAAAATCAGGCTTTAAAGAAGGAGCAAGATGCTACTTCAAGTGT
TCAAAGGCTCTTGGAAGAGAAAAACAAGATCTTGTCAGATCTAGAGAGCTCAAAGGAAGAAGAGGAGAAGAGTAAGAAAG
CAATGGAGAGTTTGGCTTCAGCATTGCACGAAGTGTCGAGTGAATCACGCGAGTTGAAAGAAAAATTGCAGAGTCAAGGT
GATCAGGATTATGAAACACAGATTGAAGATCTGAAGTTGGTCATTAAAACAACGAACAAAAAGTATGAAAATATGCTTGA
CGAGGCGAGACATGAGATTGATGTTCTTGTCAATGCGGTAGAACAAACAAAGAAACAGTTTGAGAGCGCAATGGTAGACT
GGGAGATGAGAGAAGCCGGTTTGGTGAATCACGTGAAGGAATTTGATGAAGAAGTTTCTTCAATGGGGAAAGAAATGAAT
AGGTTGGGTAATTTGGTTAAAAGGACAAAGGAAGAAGCTGATGCAGCATGGGAAAAAGAATCTCAAATGAGAGATAGTCT
AAAAGAAGTGGAAGATGAGGTGATTTATCTTCAGGAGACTCTCAGGGAAGCTAAAGCTGAAACCTTGAAAATAAAGGGGA
AAATGCTGGATAAAGAAACTGAGTTTCAAAGCATTGTTCATGAGAACGATGAACTCAGAGTGAAACAGGATGATTCTCTT
AAACAGATCAAGAAGTTGTCCAAGTTGCTCGAGGAAGCATTGGCTAAGAAACATACAGAAGAGAACAGTGAACTCAGTGA
GAGTGAGAAAGACTATGATTTGCTTCCAAAGGTGGTTGAGTTTTCTGAGGAGAATGGTCATAGAAGTGCAGAAGACGAGT
CTTGTAAAGTAAAAACCTTCGATGGCATGGACATGAAACTTGAGAGGAAGGGAGAGAAAGAAGATTCACCAGATAATGCG
ACAGTTGAAGAACTGTGGGAAAGCTGTCAGATTGAGAAGAAAGAAGGTTTCCACAGGGGGAAACCAGAACAAGAGTCTGC
AAAAGATGAGGAGGAAGAGACGAACATGAAAGACCAAAGCGAGAAAACCTCACCTGTAAATGGATTAACTGGAGAAGATG
AGCTGTTGAAGGAGAAGGAGAAGAAAAAGAAGAAGACATTGTTTGGTAAAGTTGGAAATCTTCTTAAGAAGAAAGGACCC
ATGAACCAGAAATAA