Details for Capsella Locus Carubv10012998m

Position : scaf_3 ( 5`- 3772146 .. 3776145 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012998m

Protein [Map View]
MVKETLIPPSSTSMTTGTSASSSLSMTLSSTNALSFLSKGWREVWDSADADLQLMRDRANSVKNLASTFDREIENFLNNS
ARSAFPVGSPSASSFSSEIGIMKKLQPKISEFRRVYSAPEISRKVMERWGPARAKLGIDLSAIKNAIVSEMELDERQGVL
EMGRMRRRRNRDRVRFTEFFAEAEREGEANFGDWEPIRSLKTRFKEFEKRSSSEILSGFKNSEFVEKLKTSFKSIYKETD
EAKDVPPLDVPELLACLVRQSEPFLDQIGVRKDTCDRIVESLCKCKSQHLWRLPSAQASDLIENDNHGVDLDTRIASVLQ
STGHHYDGGFWTDFLKPETSENKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKSAKQSVTLVVPWLCESDQELVYPNNLT
FSSPEEQESYIRKWLEERIGFKADFKISFYPGKFSKERRSIFPAGDTSQFIPSKDADIAILEEPEHLNWYYHGKRWTDKF
NHVVGIVHTNYLEYIKREKNGALQAFFVNHVNNWVTRAYCDKVLRLSGATQDLPKSVVCNVHGVNPKFLMIGEKIAEERS
RGEQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSELGSFNLDVYGNGEDSVEVQLAAKKHDLNLNFLKGRDHADDSLHKY
KVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVSKVKEAMTKEPLPLTPEQMYNLSWEAA
TQRFMEYSDLDKILNDGDGGHKMRKSKSVPSFNEMVDGGLAFTHYVLTGNDFLRLCTGATPRTKDYGKEHCKDLNLVPPH
VHKPIFGW*

DNA
ATGGTTAAGGAAACTCTAATTCCTCCGTCGTCTACGTCAATGACGACCGGTACATCGGCGTCTTCGTCTCTCTCGATGAC
CTTGTCCTCGACGAACGCGTTATCGTTTCTGTCGAAAGGGTGGAGAGAGGTATGGGACTCAGCTGATGCGGATTTGCAGC
TGATGCGAGACAGAGCTAACTCTGTTAAGAATCTAGCATCGACCTTCGACAGAGAGATCGAGAATTTCCTCAATAATTCG
GCGAGGTCTGCGTTTCCCGTTGGGTCTCCCTCGGCGTCGTCTTTCTCAAGTGAAATTGGTATCATGAAGAAGCTCCAGCC
CAAGATTTCGGAGTTCCGTAGGGTTTATTCGGCTCCGGAGATCAGCCGTAAGGTTATGGAGAGGTGGGGACCAGCTAGGG
CGAAGCTTGGGATCGATCTCTCGGCGATTAAGAACGCGATTGTGTCTGAGATGGAATTGGATGAGCGTCAGGGAGTTTTA
GAGATGGGTAGAATGAGGAGACGGCGTAATAGGGATAGGGTTAGGTTTACCGAGTTTTTCGCGGAGGCTGAGAGAGAGGG
AGAAGCTAATTTCGGTGATTGGGAACCGATTAGGTCTTTAAAGACTAGATTTAAAGAGTTTGAGAAACGAAGCTCATCAG
AAATATTGAGTGGATTCAAAAACAGCGAATTTGTAGAGAAGCTCAAAACCAGCTTTAAATCGATATACAAGGAGACTGAT
GAGGCTAAGGATGTCCCTCCATTGGATGTACCTGAGCTTTTGGCATGTTTGGTTAGACAATCTGAACCTTTTCTTGATCA
GATTGGTGTAAGGAAGGATACGTGCGACCGAATAGTAGAAAGCCTTTGCAAATGCAAGAGCCAACACCTTTGGCGTCTGC
CATCTGCACAAGCATCCGATTTAATTGAAAATGATAACCATGGAGTTGATTTGGATACGAGGATAGCCAGTGTTCTGCAG
AGCACCGGACACCATTATGATGGTGGCTTTTGGACTGATTTTTTGAAGCCTGAGACATCAGAAAACAAAAGGCATGTGGC
AATTGTCACAACAGCAAGTCTCCCGTGGATGACCGGAACAGCTGTAAATCCCTTATTTAGAGCGGCATATTTGGCAAAAT
CTGCAAAACAGAGTGTTACACTCGTGGTTCCTTGGCTCTGTGAATCTGATCAAGAACTAGTTTATCCAAACAATCTCACC
TTCAGTTCACCTGAAGAACAAGAGAGTTATATACGTAAATGGTTGGAAGAAAGGATTGGTTTCAAGGCTGATTTTAAAAT
CTCCTTTTACCCAGGAAAGTTTTCAAAAGAAAGGCGCAGCATATTTCCTGCCGGTGACACTTCGCAGTTTATACCATCAA
AAGATGCTGACATTGCTATACTTGAAGAACCTGAACATCTCAACTGGTATTATCATGGCAAGCGCTGGACTGATAAATTC
AACCATGTTGTTGGAATTGTCCACACAAACTACTTAGAGTACATCAAGAGGGAGAAGAATGGAGCTCTTCAAGCATTTTT
TGTGAATCATGTAAACAATTGGGTCACACGAGCGTATTGCGACAAGGTTCTTCGCCTCTCTGGGGCAACACAAGATTTAC
CAAAGTCTGTTGTATGCAATGTCCATGGTGTGAATCCCAAGTTCCTAATGATTGGAGAGAAAATTGCTGAAGAGAGATCC
CGTGGGGAACAAGCCTTCTCAAAGGGTGCATATTTCTTAGGGAAAATGGTGTGGGCTAAAGGATACAGAGAACTAATAGA
TCTGATGGCTAAGCACAAGAGCGAACTCGGGAGCTTCAATCTAGATGTCTATGGGAACGGTGAAGATTCAGTGGAGGTCC
AGCTTGCAGCAAAGAAACATGACTTGAATCTCAATTTCCTCAAAGGAAGGGACCATGCCGACGATTCCCTTCACAAGTAC
AAAGTGTTCATAAACCCTAGCATCAGTGATGTTCTATGCACAGCAACCGCAGAAGCACTAGCCATGGGGAAGTTTGTGGT
GTGTGCAGATCATCCTTCAAACGAGTTCTTCAGATCATTCCCGAACTGCTTAACTTACAAAACATCGGAAGACTTTGTGT
CCAAAGTGAAAGAAGCAATGACGAAAGAGCCATTACCTCTCACTCCCGAGCAGATGTACAATCTATCTTGGGAAGCAGCG
ACACAGAGGTTCATGGAGTATTCAGATCTCGACAAGATCTTAAATGACGGAGATGGAGGGCATAAGATGCGAAAATCAAA
ATCGGTTCCAAGCTTTAACGAGATGGTCGACGGAGGATTGGCATTCACACACTATGTTCTAACAGGGAACGATTTCTTGA
GACTATGCACTGGAGCAACACCAAGAACAAAAGACTACGGTAAAGAACATTGCAAGGATCTGAATCTTGTTCCACCTCAC
GTTCACAAACCAATCTTCGGCTGGTAG