Details for Capsella Locus Carubv10012991m

Position : scaf_3 ( 5`- 6321611 .. 6325524 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012991m

Protein [Map View]
MNRNSLYEAYGDDDDDDEDDIGEELEELRQACMVAGANSNEFSAKTNSIEADGGGGGEMPSDSEDEDDLMLRTISSQLAP
SKDADLSGGPPIGLSLPSDSDSEDDFEMIRNITSQLALPMDVPLPRIGLSDDDDEDEDFETIRVIRRRFSAYDSEANFGN
DSLGKKKQVHDLDNEPSREILSRSNTCESFPDHGKSVVTVPDSEDVRDGHSVDVHDITSTEPLDHLDTSQLSLMPAASST
FPEAAQAFVDAIRKNRAYQKFLRRKLEVIEATIEQNEKHRKNVKIVKDFQASCKRRTKLALSQRKDPRVELISARKCVPC
DSSEGNDKKTSPLMLGPPENPFVAKYRMALEKYPVSVERRNWSTEENKNLAKGLKQEVQKILLYEAIEQSRDLEDSTYDI
DTINESIRNLEITPEMIRQFLPKINWDSLDIKDRSAAECEARWMSSEDPLINHGPWTEAEDKNLPRIIEEKGLTDWVEIA
VSLGTNRTPFQCLARYQRSLNPSILRKEWTPEEDDQLRAAVELFGDKDWQSVANVLKGRAGTQCSNRWKKSLRPTRKGRW
SLEEDKRVKVAVTLFGSQNWHKISQFVPGRTATQCRERWVNCLEPKVNRGKWTEEEDEKLKEAIGKHGYSWSKVASHLAC
RTDNQCLRRWKTLYPHQVVLLQQARRLRKEAIVGNFVDRESERPALVTGAILALPEISLEPDPDSVALKNKRKAKQRKSD
AERQPKRRRKGLEKCSGDVIRQENATVCEKEPNNGGEEKSLELERYNEIQDNAKEKQRRSRKRVAETPNNTTGLRKLTPR
RKKVSAVVPIKNQDALN*

DNA
ATGAACCGGAACAGCCTTTACGAGGCTTACGGCGATGATGACGATGACGATGAAGACGACATCGGTGAAGAACTCGAAGA
GTTAAGACAGGCCTGTATGGTCGCCGGCGCCAATTCCAATGAATTCTCCGCTAAAACCAATTCTATTGAAGCGGATGGAG
GCGGTGGCGGAGAGATGCCGTCGGATTCGGAGGACGAGGACGATTTGATGCTTCGTACCATTAGCAGCCAATTGGCACCG
TCCAAGGATGCGGATTTGAGCGGTGGTCCTCCCATTGGTTTATCATTGCCCTCTGATTCGGACAGTGAAGACGATTTCGA
GATGATACGTAACATTACGAGCCAACTAGCTTTGCCCATGGATGTTCCCCTTCCTCGCATTGGTTTATCAGACGATGACG
ATGAAGATGAAGACTTTGAAACTATTCGAGTTATTCGTAGGCGATTCTCTGCTTATGATTCAGAAGCAAATTTCGGGAAT
GATTCTCTCGGGAAGAAAAAGCAGGTACATGACTTGGACAATGAACCTTCACGCGAAATATTGAGTAGATCTAATACTTG
TGAAAGCTTTCCAGATCACGGGAAATCAGTGGTCACAGTGCCAGATTCAGAGGATGTACGAGATGGCCATTCTGTTGATG
TACATGACATTACTTCCACTGAGCCTCTTGACCACCTGGACACAAGCCAGTTATCTCTTATGCCAGCTGCGAGTTCAACT
TTCCCTGAAGCTGCACAAGCCTTTGTTGATGCAATCAGGAAGAACAGGGCATATCAGAAATTTCTTAGAAGAAAATTGGA
AGTAATAGAAGCCACAATCGAGCAGAACGAGAAACACAGGAAAAATGTTAAAATAGTTAAAGATTTTCAAGCTTCTTGCA
AGAGAAGAACTAAACTGGCACTTTCTCAGAGGAAAGATCCTCGTGTCGAATTAATCTCAGCACGCAAATGTGTGCCTTGT
GATAGCTCCGAGGGTAATGATAAAAAGACATCTCCTTTGATGTTGGGTCCGCCGGAAAATCCTTTTGTTGCAAAGTATAG
GATGGCATTAGAGAAATATCCAGTTTCAGTGGAACGCAGAAATTGGTCTACTGAGGAGAACAAAAACCTTGCAAAAGGGC
TAAAACAAGAAGTTCAAAAGATACTACTTTATGAAGCTATTGAACAGTCCAGGGATTTGGAAGATTCTACATATGATATA
GACACCATCAATGAATCAATCAGAAATCTTGAGATAACACCAGAAATGATTAGGCAGTTTCTTCCAAAAATTAATTGGGA
TTCGTTGGATATCAAGGACCGGTCTGCTGCAGAATGTGAAGCTCGGTGGATGAGCTCGGAAGATCCATTAATTAACCACG
GTCCGTGGACTGAAGCAGAGGACAAAAACCTACCCCGAATTATCGAAGAAAAGGGTCTAACAGACTGGGTTGAAATTGCG
GTATCACTAGGGACAAATAGGACCCCATTTCAATGTTTGGCTCGATATCAGAGAAGCTTGAATCCAAGCATATTGAGAAA
AGAATGGACTCCTGAGGAAGATGACCAACTTCGTGCTGCAGTAGAGTTATTTGGCGATAAAGACTGGCAATCTGTTGCAA
ATGTATTAAAAGGAAGAGCTGGAACTCAGTGCTCAAACAGATGGAAAAAGTCCCTTCGCCCTACGAGAAAAGGGAGATGG
AGCTTAGAGGAAGACAAACGTGTGAAAGTAGCTGTGACACTCTTTGGATCTCAAAACTGGCATAAGATTTCTCAGTTTGT
TCCTGGACGGACTGCGACTCAGTGTCGAGAGAGATGGGTAAATTGTTTAGAGCCCAAAGTAAATCGTGGGAAGTGGACTG
AGGAAGAGGATGAAAAGTTGAAAGAAGCGATTGGAAAACATGGATATAGCTGGTCCAAGGTAGCTTCACATTTGGCTTGT
CGTACTGACAATCAGTGCTTGAGGAGATGGAAGACTTTATATCCTCATCAAGTGGTTCTTTTGCAACAAGCTAGAAGGTT
ACGAAAAGAAGCTATTGTAGGTAATTTTGTTGACAGGGAATCAGAGCGTCCTGCTCTTGTCACAGGCGCTATTTTGGCAT
TACCGGAGATATCTCTAGAGCCAGATCCCGATAGTGTAGCCCTGAAGAATAAACGCAAAGCCAAACAGAGAAAGTCAGAT
GCAGAGAGACAACCAAAGAGACGGAGAAAAGGATTAGAGAAATGCTCAGGAGATGTAATTAGACAAGAGAATGCGACTGT
TTGTGAAAAGGAACCAAACAATGGAGGAGAGGAGAAGTCATTGGAATTGGAAAGGTATAACGAGATCCAAGACAATGCAA
AGGAGAAACAAAGACGAAGTCGCAAACGTGTTGCAGAAACACCGAACAACACCACTGGTTTAAGGAAACTTACGCCTAGG
AGGAAGAAAGTGTCTGCAGTAGTTCCTATCAAGAACCAAGACGCACTAAATTAG