Details for Capsella Locus Carubv10012988m

Position : scaf_3 ( 5`- 6785719 .. 6790686 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012988m

Protein [Map View]
MPLAYTFPVLPSSCLLCGISNRGTSFVVDRPELQISGCLVVRSDSGEFVASGLSLRQFQREGRRRLNAAGGGGGVHVVDN
APSRTSSLAASTSTIEIPVTCYQLIGVSDQAEKDEVVKSVLNLKKADAEEGYTMEAAIARQDLLMDVRDKLLFEPEYAGN
LKEKIAPRSPLRIPWAWLPGALCLLQEVGQEKLVLDIGRAALRNLDSKPYIHDIFLSMALAECAIAKAAFEANKVSLGFE
ALARAQCFLKSKVTLGKLALLTQIEESLEELAPPCTLDLLGLPRTPENAERRRGAISALRELLRQGLSVEASCQIQDWPC
FLSQAISRLLATEIVDLLPWDDLAITRKNKKSLESHNQRVVIDFSCFYMVLLAHIAVGFSGKQNDTINKAKIICECLITS
EGVDLKFEEAFCSFLLKQGSEAEALEKLKQLESNSDSAVRNSILGKESRSASATPSLEAWLTESVLANFPDTRGCSPSLA
NFFRAEKKYPENKKIGSPLIINHKTNQRPLSNTQFVNSSQHLYTAVEQLTPSELQSPVISATNIDESGASMPSVQLKRNL
GVKQNKIWDDWLTQSSLIGRVSVAALLGCTVFFSLKLIGIRPGRLQSPPIWVSARPHSESDSILSKTASGSFRRNLGSVN
RNGIVGNIKVLFNMLKMNHGEHSDALYLKSSGLSATSLSHSASEVHKRPMVTEDAEELVRQWENIKAEALGPTHQVYSLS
EVLDGSMLVQWQTLAETAKAKSCYWRFVLLHLEILRAHIFEDGIAGETAEIEALLEEAAELVDESQPQNAKYYSTYKIRY
TLKKQEDGSWKFCESDIQIQK*

DNA
ATGCCACTGGCTTACACATTTCCGGTTCTCCCTTCTTCTTGTCTGCTTTGCGGAATCTCTAATCGCGGCACCAGCTTCGT
CGTAGATCGCCCGGAGCTTCAGATCTCAGGTTGCCTCGTCGTGCGTTCTGATTCCGGTGAATTCGTTGCTTCTGGTTTAT
CTTTGCGGCAGTTCCAGCGGGAAGGGCGGAGGAGGTTGAACGCTGCGGGTGGTGGTGGTGGTGTCCATGTCGTGGACAAT
GCGCCGTCTCGTACTTCTTCCCTCGCTGCCTCTACCTCCACAATCGAAATCCCGGTTACCTGTTACCAGCTTATTGGAGT
TTCTGATCAAGCTGAGAAAGACGAGGTTGTGAAGTCGGTTCTAAATTTGAAAAAAGCTGATGCTGAAGAGGGTTATACAA
TGGAAGCTGCTATAGCTCGCCAGGATCTTCTCATGGATGTTAGGGATAAACTCCTTTTTGAACCAGAATATGCTGGTAAC
CTAAAAGAAAAGATTGCTCCTAGATCTCCTCTCAGAATTCCGTGGGCATGGTTACCTGGTGCTCTATGCCTTCTTCAAGA
GGTTGGACAAGAAAAACTTGTGCTGGATATTGGCCGGGCTGCTCTCAGGAACCTTGATTCGAAGCCATATATTCATGATA
TATTCTTATCTATGGCACTTGCTGAGTGTGCAATTGCCAAGGCTGCTTTCGAGGCTAACAAGGTCTCTCTAGGATTTGAA
GCTCTTGCTCGTGCCCAATGTTTTCTGAAGAGTAAAGTTACCCTTGGGAAACTTGCATTGTTAACTCAGATTGAGGAGTC
ACTGGAGGAGCTTGCACCACCATGCACATTGGATCTACTGGGCCTGCCTCGCACGCCAGAAAATGCAGAGAGGAGACGAG
GTGCAATTTCAGCACTACGCGAACTGCTCAGACAGGGCTTAAGTGTTGAAGCTTCATGTCAAATCCAAGACTGGCCATGC
TTTTTGAGTCAGGCAATTAGCAGGTTATTGGCTACAGAGATTGTTGATCTTCTTCCATGGGATGACTTAGCCATAACACG
GAAAAATAAAAAATCACTTGAATCCCACAATCAAAGAGTGGTAATTGATTTTAGCTGCTTCTACATGGTGTTGCTTGCTC
ATATCGCTGTTGGATTTTCAGGCAAGCAAAATGATACGATTAATAAAGCAAAAATTATATGCGAATGTCTCATAACATCA
GAAGGTGTTGATCTGAAATTTGAGGAAGCTTTTTGCTCATTTCTTTTAAAACAGGGTTCCGAGGCAGAAGCCCTTGAAAA
ACTTAAGCAGCTGGAATCAAATTCAGATTCTGCCGTCCGTAATTCAATCCTGGGGAAGGAGTCGAGAAGTGCTTCTGCTA
CTCCATCATTGGAAGCTTGGCTAACGGAGTCTGTGCTTGCTAACTTTCCAGACACAAGGGGTTGTTCTCCATCTTTGGCC
AATTTTTTTCGGGCTGAAAAGAAATATCCAGAGAACAAGAAAATAGGATCACCTTTGATCATTAATCACAAGACGAACCA
AAGACCACTTTCCAATACGCAGTTTGTGAATTCGTCACAACATCTTTATACAGCTGTCGAGCAGTTGACTCCATCAGAAT
TGCAGAGCCCAGTTATATCAGCAACAAATATTGATGAAAGCGGTGCCAGTATGCCATCAGTCCAACTTAAGAGGAACCTT
GGTGTAAAACAAAATAAAATATGGGATGATTGGCTCACTCAAAGTAGTCTGATCGGAAGGGTATCTGTTGCTGCTTTATT
GGGTTGCACTGTGTTCTTCTCTCTAAAACTAATAGGCATTAGGCCTGGTAGACTACAGAGTCCGCCTATATGGGTTTCTG
CAAGGCCGCATTCAGAATCAGATTCTATCCTGTCTAAAACAGCGTCTGGGAGTTTCAGAAGAAACCTTGGTTCTGTGAAT
AGAAATGGTATCGTAGGCAACATCAAAGTGCTCTTCAACATGTTAAAGATGAATCATGGTGAACATTCAGATGCCTTGTA
TCTGAAAAGCTCTGGTCTATCAGCTACATCATTGTCTCATTCCGCATCAGAAGTGCATAAGAGACCTATGGTTACAGAAG
ACGCCGAAGAGCTTGTGAGACAGTGGGAAAATATTAAGGCTGAAGCTCTTGGACCAACGCACCAAGTTTATAGCCTATCC
GAAGTCCTTGATGGATCTATGCTTGTCCAGTGGCAAACGTTGGCAGAAACAGCAAAAGCTAAATCTTGTTATTGGAGATT
CGTTTTGCTGCATCTAGAGATTTTGAGAGCACACATTTTCGAAGATGGTATCGCCGGTGAGACTGCAGAAATCGAGGCCC
TTCTGGAGGAAGCAGCAGAATTAGTTGATGAATCGCAGCCCCAAAACGCAAAATATTACAGCACTTACAAGATCCGCTAT
ACGCTGAAGAAGCAAGAAGATGGATCATGGAAATTCTGCGAAAGTGATATTCAAATACAGAAATGA