Details for Capsella Locus Carubv10012987m

Position : scaf_3 ( 5`- 6635004 .. 6643685 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012987m

Protein [Map View]
MNLPWPESPSELIWLHHRKSHLQEIEISFFSTLFFAFFLLRQVTHTFESRQFGVWYLSIYCSFSVMDIDFNEYKLRCELR
GHDDDVRGICVCSDDNIATSSRDRTIRVWSLDPSDKRKYTSSKILLGHTSFVGPLAWIPPTDDYPEGRLVSGSMDTFVFV
WNLINGENIQTLKGHQMQVTGVTLDKEDIVSSSVDQTLKRWRNGQLVESWEAHQSPVQAVIKLPSGELVSGSSDATLKLW
KGKTSLRTLSGHTDTVRGLAVMPDLGFLSASHDGSIRLWALSGEVLLEMVGHTSIVYSVDAHSSGLIASGSEDRHAKIWK
DGVCVQSLEHPGCVWDVKFLESGDIVTACSDGVVRVWTVRHGVIADQMEIDAYDSQISQYKLSRKKVGGLKLDELPGLDS
LTSPGTSDGQTKVVREGDNGVAYAWNMKEQRWDKIGEVVDGPDGVADRPILDGFQYDFVFDVDIGDGEPIRKLPYNRSDN
PYDAADKWLLKENLPFGYRQQIVEFILQNSGQKDVNFNPSFRDPFTGANAYVPGQASQTAATPAKPLYKHIPKRGVLVFD
VAQYDGILKKMTEFNTTLRSDSVNNDKSLTEVEVSRVGAIITILKDTSHYHSTNFADMDIDLLLKVLQAWPPAMMFPATD
IVRMLVLHPHGASLLIKHVENNNDLLLDLIKKVTEDSALPANLLTTVRVLVNLFKNSSFHYWLQTHHSQILDAFSNCYSS
PNKNLQLAYSTLLLNYAVLLIEKKDEEGQAQVLSAALQVAEEEAADVDSKFRSLVAIGSLMLEGSVKKIAVDFDVASIAK
SAKASKEAKIAEVGADIDLVIRQ*

DNA
ATGAATCTTCCATGGCCAGAATCACCATCAGAGCTCATATGGTTACATCATCGTAAGAGTCACCTGCAGGAAATAGAAAT
TAGTTTCTTCTCTACTCTCTTCTTTGCTTTCTTCCTCCTTCGTCAAGTCACACACACTTTTGAGTCGCGGCAATTTGGCG
TTTGGTATCTCTCTATCTACTGCTCCTTCTCAGTCATGGATATCGATTTCAATGAGTACAAGCTCAGGTGCGAGCTTCGT
GGCCACGATGATGATGTTCGTGGGATATGTGTCTGTAGTGATGACAATATAGCTACTTCATCAAGGGATAGAACCATAAG
GGTTTGGTCACTGGATCCATCTGATAAGCGCAAGTATACATCCTCTAAGATTCTGTTGGGTCATACTAGCTTTGTTGGGC
CACTTGCATGGATTCCACCAACTGATGATTACCCTGAAGGGAGACTTGTCTCCGGGAGTATGGATACTTTCGTGTTTGTT
TGGAACCTGATTAATGGAGAGAATATTCAGACATTGAAGGGTCATCAGATGCAAGTCACTGGTGTTACTCTTGATAAGGA
GGACATAGTGTCGTCTTCAGTTGACCAAACTCTGAAACGATGGAGAAACGGTCAGCTTGTTGAATCTTGGGAGGCACACC
AGTCACCTGTCCAGGCGGTGATAAAGCTGCCATCTGGTGAGCTCGTATCAGGTTCAAGTGACGCCACTCTCAAACTCTGG
AAGGGAAAAACGAGTCTACGAACTCTTTCAGGGCATACAGATACTGTTAGAGGGTTAGCTGTGATGCCTGATTTAGGATT
TCTTTCCGCATCACATGATGGTTCAATCAGGTTATGGGCACTAAGTGGCGAAGTTCTTCTGGAGATGGTTGGCCACACCT
CCATTGTTTATTCAGTTGACGCACATTCATCTGGTCTTATTGCTAGTGGCAGTGAAGATCGCCATGCCAAGATATGGAAA
GATGGAGTCTGCGTTCAGAGTTTGGAACACCCAGGTTGTGTCTGGGATGTCAAGTTTTTAGAAAGCGGGGATATTGTGAC
GGCATGTTCAGATGGAGTGGTTCGTGTTTGGACAGTACGTCATGGCGTGATTGCAGATCAGATGGAGATTGATGCTTATG
ATTCCCAAATTTCTCAGTACAAATTGAGCAGGAAAAAGGTTGGCGGATTGAAACTTGACGAGCTGCCAGGGCTTGATTCT
CTGACTTCACCAGGTACCAGTGATGGCCAGACAAAAGTAGTAAGGGAAGGAGACAATGGTGTTGCTTATGCTTGGAATAT
GAAAGAGCAGAGATGGGACAAAATTGGTGAGGTTGTTGATGGCCCAGATGGTGTGGCTGATCGTCCAATTCTCGATGGAT
TTCAATATGATTTTGTTTTTGATGTTGACATTGGTGATGGGGAACCTATCCGGAAGCTACCTTACAATCGATCAGACAAT
CCTTATGATGCAGCTGACAAGTGGCTTCTGAAAGAAAATCTTCCCTTTGGATATCGGCAACAAATTGTTGAATTTATATT
ACAAAATTCTGGGCAGAAAGACGTCAACTTTAATCCATCTTTTCGTGATCCCTTCACTGGCGCAAATGCTTATGTGCCTG
GGCAAGCATCACAAACAGCTGCAACTCCAGCAAAACCTTTATACAAGCACATTCCAAAAAGAGGTGTGCTTGTTTTCGAT
GTTGCTCAATATGACGGAATTCTGAAAAAGATGACAGAATTTAATACTACTTTACGATCTGACTCGGTAAACAATGACAA
GTCCCTGACAGAAGTCGAAGTATCCAGAGTAGGCGCAATCATTACTATACTCAAGGACACATCACACTACCACTCCACCA
ATTTTGCTGACATGGATATTGATTTGCTTTTGAAAGTGCTACAAGCATGGCCGCCTGCAATGATGTTTCCTGCTACTGAT
ATAGTCAGGATGCTTGTCTTGCATCCTCACGGAGCAAGTCTACTTATTAAGCATGTGGAAAACAACAATGACCTGCTTTT
GGATTTGATAAAGAAAGTCACAGAAGATTCAGCACTTCCTGCAAATCTTTTAACGACCGTTCGTGTCCTGGTTAATTTGT
TCAAGAATTCTTCATTTCATTACTGGCTACAGACCCATCATAGCCAAATTCTTGATGCCTTCTCAAACTGTTATTCATCC
CCAAATAAGAATCTGCAGTTGGCTTATTCGACGTTGCTTCTCAATTATGCAGTGCTGTTAATAGAAAAGAAGGATGAAGA
AGGTCAAGCTCAAGTCCTTTCAGCAGCATTACAGGTTGCAGAAGAGGAAGCTGCAGATGTTGATTCCAAGTTCCGGAGTT
TGGTAGCAATCGGGTCACTGATGCTTGAAGGTAGCGTGAAGAAGATAGCGGTAGATTTTGATGTGGCGAGCATTGCAAAA
TCAGCAAAAGCCTCAAAGGAAGCCAAGATTGCAGAAGTTGGGGCCGATATCGATCTTGTAATTCGTCAGTAA