Details for Capsella Locus Carubv10012985m

Position : scaf_3 ( 5`- 8057463 .. 8060546 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012985m

Protein [Map View]
MAGSALPLPPPPPLSLQSPSQNQTRHSSTFSPPTLPPQTPSIRSRLSKICQDGNPQLARQLFDAIPKPTTVLWNTIIIGF
ICNSMSQEALLFYSRMKKTAPFTKCDAYTYSSTLKACAETKNLRAGKAVHCHLIRCLQNSSRVVHNSLMNMYVSCVDAPS
GELDSSKYDVVRKVFDNMRRKNVVAWNTLISWYVKTGRNAEACRQFAIMMRMEIKPSPVSFVNVFPAVSTSKSIKKANVF
YGLMLKLGDEYVKDLFVVSSAISMYAELGDFESSRRVFDSCVERNIEVWNTMIGVYVQNDCLVESIELFLEAVGSEEIVS
DEVTFLLAASAVSALQQVELGRQFHGFVSKKFRELPIVIFNSLMVMYSRCGSVHESFGVFHSMRERDVVSWNTMISAFVQ
NGLDDEGLMLVYEMQKQGIKIDYITVTALLSAASNLRNKEIGKQTHGFLIRHGMQFEGMNSYLIDMYAKSGLIMMSQKLF
ERSGYTERDQATWNSIISGYTQNGLTEETFVVFRKMLEQNIRPNAVTVASILPACSQIGSVDLGKQLHGFSIRQCLDENV
FVASALVDMYSKSGTIKYAENMFSQTKKRNSVTYTTMILGYGQHGMGERAISLFRSMQDSGIKPDAITFVAVLSACSYSG
LVDEGFKIFEEMKEVFNIQPSSEHYCCITDMLGRVGRVNEAYEFIKELGEEGNIAELWGSLLGACRLHGELELAETVSER
LAELDKGKNFSGYQVLLSNMYAEEQNWKSVDRVRRGMREKGLRKEVGRSGIEVAGNVNCFVSRDQEHPQSGEIYDVIEGL
AKDMRGDSYLTTIPTVTPSLELDE*

DNA
ATGGCTGGATCAGCTCTACCTCTACCACCGCCTCCGCCACTATCATTACAATCTCCGTCGCAGAATCAAACCCGTCATTC
TTCTACCTTTTCTCCACCAACCCTCCCTCCTCAAACACCTTCAATCCGTTCCCGTCTCAGCAAAATCTGTCAAGATGGAA
ACCCACAACTTGCACGCCAACTGTTCGACGCAATTCCTAAACCAACCACTGTTCTTTGGAACACCATCATTATCGGGTTT
ATTTGCAATAGTATGTCACAGGAAGCTCTTCTTTTCTATTCCCGGATGAAAAAGACGGCACCTTTTACTAAATGTGATGC
TTATACTTACTCTTCGACACTCAAGGCGTGTGCTGAGACTAAGAACTTGAGAGCTGGTAAAGCTGTGCATTGTCATTTGA
TCCGTTGTTTACAGAATTCTAGCAGGGTTGTGCATAACTCTCTGATGAATATGTATGTTTCGTGCGTGGACGCTCCTAGT
GGTGAATTGGATTCTTCTAAGTATGATGTGGTGCGTAAAGTTTTCGATAATATGCGTAGGAAGAACGTTGTGGCTTGGAA
TACGTTGATTTCTTGGTATGTGAAAACAGGGAGAAACGCAGAAGCGTGTAGGCAGTTTGCTATAATGATGAGAATGGAGA
TAAAACCGAGCCCTGTTAGTTTTGTCAATGTTTTCCCTGCGGTGTCGACTTCTAAAAGCATTAAGAAAGCTAATGTTTTT
TATGGTTTGATGCTTAAATTGGGAGATGAATATGTGAAGGACTTGTTTGTGGTGAGTTCGGCTATTTCTATGTATGCTGA
ACTTGGCGATTTTGAATCATCACGGAGAGTATTTGATTCTTGTGTTGAGAGAAACATTGAGGTGTGGAATACAATGATAG
GTGTCTATGTTCAGAATGATTGCCTAGTTGAAAGCATAGAGCTTTTTCTTGAAGCAGTAGGATCGGAAGAGATAGTGTCC
GATGAAGTAACGTTCCTTTTGGCAGCGAGTGCAGTTTCAGCACTGCAGCAAGTGGAACTAGGCAGGCAGTTTCATGGTTT
TGTGAGCAAAAAATTTCGAGAGCTACCAATTGTGATATTTAATTCGTTGATGGTGATGTACTCAAGGTGTGGTTCTGTGC
ATGAGTCATTTGGAGTCTTTCATTCAATGCGAGAGAGAGATGTTGTATCATGGAACACTATGATCTCTGCATTTGTTCAA
AATGGCCTAGATGATGAAGGATTAATGCTAGTTTACGAGATGCAGAAGCAAGGGATTAAGATTGATTACATAACTGTGAC
GGCTTTGCTTTCAGCTGCATCAAATCTTAGAAACAAGGAGATTGGGAAGCAGACTCATGGTTTTCTTATCAGGCACGGGA
TGCAGTTCGAGGGAATGAACAGTTACCTTATCGACATGTATGCTAAGTCAGGTTTAATTATGATGTCACAGAAGCTTTTT
GAGAGAAGTGGTTATACTGAAAGAGATCAAGCTACTTGGAATTCTATAATTTCCGGGTACACTCAGAATGGGCTCACAGA
GGAAACGTTTGTTGTGTTCCGAAAGATGTTAGAACAGAATATCCGACCCAATGCTGTAACTGTGGCATCAATTCTCCCTG
CTTGTAGCCAAATAGGTAGTGTTGACTTAGGTAAACAGCTCCATGGTTTTTCTATTAGGCAATGCTTGGATGAGAACGTA
TTTGTTGCTTCAGCGTTAGTTGATATGTATTCAAAGTCAGGAACGATAAAGTATGCAGAAAACATGTTTTCACAAACGAA
AAAGAGAAACTCTGTGACATACACCACAATGATATTGGGCTACGGTCAACATGGGATGGGAGAGAGAGCTATCTCGCTGT
TTCGTTCCATGCAAGATTCGGGAATCAAACCGGACGCTATCACCTTTGTTGCTGTTTTATCAGCTTGCAGCTACTCGGGT
CTAGTGGACGAAGGTTTTAAAATATTCGAGGAAATGAAAGAAGTTTTTAACATTCAGCCTTCAAGTGAGCACTATTGCTG
CATTACAGACATGTTGGGGAGAGTTGGACGGGTTAATGAAGCCTATGAGTTTATTAAAGAACTTGGTGAAGAAGGAAACA
TAGCTGAGCTATGGGGTTCACTTCTTGGGGCATGTAGACTGCACGGTGAGCTTGAGCTTGCTGAAACTGTTTCAGAGAGG
TTAGCTGAATTAGATAAAGGAAAGAACTTTTCCGGGTATCAGGTTTTGCTCTCGAATATGTATGCTGAGGAACAAAATTG
GAAGAGCGTTGATAGAGTTAGGAGAGGAATGAGGGAAAAGGGTTTAAGGAAAGAAGTTGGTCGTAGTGGTATTGAAGTTG
CTGGTAATGTCAACTGTTTTGTGTCTAGAGATCAAGAGCATCCTCAGTCTGGTGAGATTTATGATGTAATTGAGGGTTTG
GCTAAAGATATGAGAGGCGATTCGTATCTGACAACAATCCCAACTGTCACTCCAAGTTTGGAATTGGACGAGTGA