Details for Capsella Locus Carubv10012978m

Position : scaf_3 ( 5`- 6240769 .. 6245603 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012978m

Protein [Map View]
MNFLLRSASSATHRPPVSEPPATPPQPQPETTKSGATLEGLIAEEPFPQYPSVEDLDRVADGSRDDDGSGESNAKSGASC
IERFSDVSEEEGWIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIITPFKVAEVMSRTGQRK
ASEKQNGDMSDEASTPSGDGEMSPDAQFATQNGDSPGKDSLDSQKDLSDGESILRMEDHKRRTEDLLSRFQKSHFFVRIA
ESGEPLWSKKSSLVADTEMDEKRKSRPCVSAFVDRGDFDPNVSGGVARSKAKCCALPNGDIVVSLQVYIVDCPKEPIIEI
LQFEKHQDKDQTSENDKDPYGNLLKWLIPLDNTISQQPRSLPPPLSPSPSISSTAHKPAISSTSGSQLFSFGHFRSYSMS
ALPPNTAPVSGPMKTQSSKPSFDIEDWDSYSGQTLRNSQKAGTEELLSFRGVPLEGDRFSVRCGLEGICIPGRRWRRKLE
IIQPIEINSFAADCNTDDLLCVQIKNVAPIHAPDIVIYIDAITIVFEEAGKNASPSSVPIACIEAGNEHSLPNLTLRKGE
EHSFIVKPAFSVGSNLKPSAARKELKTSSLSLPTVNFERKGSSLSGDQYAVMVSCRCNYTESRLFFKQRTKWRPRVSRDL
MISVASEMSGEPCGPHGRASQLPVQILTLQASNLTSEDLSLTVLAPASFTSPPSVVSLNSTPTSPLSPFLGFSEFTERVQ
SEKRNSTMRKHQSLPPISLETRTENTNGESSNPSDVVPKSGLGCTHLWLQSRVPLGCVPSKSTATIKLELLPLTDGIITL
DTLQIHAKEKGRRYIPEQSLKINATSSISSGIL*

DNA
ATGAATTTCTTGCTTCGATCTGCTTCTTCTGCTACTCATCGGCCGCCGGTGAGCGAGCCACCAGCTACGCCGCCACAACC
TCAGCCTGAAACAACCAAGTCGGGAGCAACTTTGGAAGGTCTAATAGCAGAAGAGCCTTTCCCGCAATATCCATCAGTTG
AAGATCTTGATCGTGTTGCTGATGGATCTAGAGACGATGATGGTAGTGGAGAGTCAAATGCAAAGTCTGGTGCCTCTTGT
ATAGAGAGATTCTCAGATGTTTCTGAGGAAGAAGGATGGATCGCTATTCCTTATAAGGAAATCCCGGACAACTGGTCTGA
GTCTGTTGATATTCATTCATTACGTTCCCTGGATCGTTCCTTTGTTTTCCCTGGGGAGCAGATTCAAATCCTTGCATGCT
TATCTGAGAGTAAAGGAGACACAGAGATCATTACCCCTTTTAAGGTTGCTGAGGTAATGAGCAGAACTGGACAGAGAAAG
GCCTCTGAAAAACAAAATGGAGACATGTCTGATGAGGCAAGTACACCATCAGGGGATGGAGAAATGAGTCCTGATGCTCA
GTTTGCAACTCAGAATGGTGACAGCCCTGGTAAAGATAGTTTGGATTCACAAAAGGATTTATCTGATGGTGAATCAATCT
TGAGGATGGAAGATCATAAGAGACGAACAGAAGACTTGCTTTCCAGGTTTCAGAAGTCTCATTTCTTTGTTAGGATTGCA
GAGTCTGGTGAGCCACTTTGGTCAAAGAAAAGCTCTCTCGTCGCAGATACAGAGATGGATGAAAAGAGGAAAAGTAGACC
TTGTGTTAGTGCTTTTGTAGATAGAGGAGACTTCGATCCTAATGTATCTGGAGGTGTAGCTAGAAGTAAGGCAAAATGCT
GTGCCTTACCCAATGGAGATATAGTGGTCTCTTTACAAGTTTATATTGTCGACTGTCCCAAAGAACCCATCATAGAGATA
CTGCAGTTTGAGAAGCATCAGGACAAGGACCAAACTTCTGAGAATGATAAAGATCCATATGGGAATCTCTTAAAGTGGTT
GATACCGTTGGATAACACTATTTCTCAACAACCCCGCTCTCTACCACCTCCTTTAAGCCCTAGCCCAAGTATCAGCAGCA
CTGCACACAAGCCAGCAATTTCGTCTACCTCAGGCTCCCAACTCTTCTCATTCGGCCATTTTAGAAGCTACTCCATGTCT
GCTCTTCCTCCAAACACCGCACCAGTATCTGGACCCATGAAAACACAAAGCTCGAAACCATCATTTGATATTGAAGATTG
GGACAGTTACTCTGGTCAAACGTTACGAAACAGTCAGAAGGCTGGAACTGAAGAGCTTTTATCTTTCCGGGGTGTCCCGT
TGGAGGGGGATAGGTTCTCTGTTCGTTGTGGACTCGAAGGTATCTGCATTCCGGGTAGAAGGTGGAGGAGGAAACTCGAG
ATCATCCAACCTATCGAGATAAATTCTTTTGCAGCTGACTGCAATACAGATGATCTTCTCTGCGTTCAGATAAAGAATGT
GGCTCCTATCCACGCTCCAGATATTGTAATATACATAGACGCCATAACAATTGTTTTTGAAGAGGCTGGAAAAAATGCTT
CCCCTTCATCAGTACCAATTGCATGTATTGAAGCTGGAAATGAGCACAGTTTACCGAATTTAACACTAAGGAAAGGTGAG
GAGCACTCATTCATCGTGAAGCCTGCTTTTTCTGTTGGAAGTAATCTGAAGCCCTCTGCTGCAAGAAAAGAACTCAAAAC
ATCGAGTTTATCTCTTCCAACTGTAAATTTTGAAAGAAAAGGAAGCAGTTTAAGTGGTGATCAGTATGCAGTTATGGTGT
CATGTCGGTGCAACTACACAGAATCAAGGCTATTTTTTAAACAACGGACAAAATGGAGACCACGAGTTTCAAGGGACCTG
ATGATCTCTGTTGCGTCTGAAATGTCAGGAGAACCTTGTGGTCCTCATGGGAGAGCCTCTCAACTACCCGTTCAGATTTT
AACTCTTCAGGCATCGAATTTGACATCAGAAGATCTGTCTTTGACCGTTCTCGCTCCTGCATCCTTTACATCACCTCCAT
CTGTAGTTTCCCTAAACTCCACGCCGACGTCCCCTCTAAGTCCATTCCTAGGATTCTCTGAGTTCACAGAGCGGGTACAA
AGCGAGAAACGCAATTCAACGATGCGTAAACATCAATCGTTACCCCCAATTTCACTGGAGACAAGAACAGAGAACACAAA
TGGTGAATCTTCCAATCCTTCAGATGTAGTTCCGAAGAGCGGCTTAGGTTGCACACATCTCTGGCTACAAAGTCGAGTTC
CCTTGGGATGCGTTCCTTCAAAATCTACAGCTACGATCAAGCTAGAGCTACTCCCTTTGACTGATGGCATAATCACGCTT
GATACTCTCCAGATCCACGCCAAGGAGAAAGGTCGTAGATATATTCCAGAGCAGTCTCTGAAGATAAACGCAACTTCAAG
CATTTCCTCTGGGATTTTGTAG