Details for Capsella Locus Carubv10012965m

Position : scaf_3 ( 5`- 4734830 .. 4739979 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012965m

Protein [Map View]
MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDPDEAVQKLIHQDPFHEVKRKRDRKKEDTVVVE
PANRKKPLESVTSEVKVRTQPEYNVRRGGYHRNFVPRNAAQRNAFPRNPATGSNREFRVVRDNRSNPNVDEELKHSSGSN
INKVVATVNKKGSTSGLDNHDSSGAQDVTDDRNTAADVRPRQPEIAPLHRPTNKGFSDGKQTVGGVTLPPTNSVLGVYAS
STDPVHVPSPVSRSSPVGAIKREVRGGGFGKPSENVGKEPSVRSFPGSTIRKNGPPNAYRPSSPTPKIDHSQTTAREPNM
PSGVEKSRSFLNRQRGNRGSQYARTQQVGGHTKGVSQNKEWKPKSTQKPVGHNPGVIGTPTKSQARRPADNSINVESEAV
ELQDKLSHVHISESQNVIIADHIRIPETDRCHLTFGSFVQEFDSSRNSASAIQESCSLEELRDSDHSLPVSCPEASTDGP
DVQPINILDDHVRISASESPVSPVSEPQLPEQKEINRSDNLDEYSGVQSLNRNGPPYTPLQFEQQQDPPELQKFSAYDHH
GGYEFPYFNPATDETMRGQGLPSPQEQVLSTHMVNNAPPSTIPMLQQQQQASMQQMYPQVHVSHYPNLMPYRQFLSPFYV
PQVPMTGYSGNPAAYAHPSNGNGYVLMPAGGSNGVKYGIHQQFKPVATSGHTGFQTYNNPSGYPMNSPNVVGNATGLEDS
SRMKYKDGNIYTPNPQSETSEIWMTNPRDLSSLQSPQYYNVAGQTPHGTYLSSHTAHPSFNAAAGAAQPSHMQFQGLFHP
PQPGTMANQHHMGPGLGGNVGVGVVPSPPPSQVGTYQQSQIGHPNWPANF*

DNA
ATGGTGACTGGGTCCAGAACTAGCGGTAATCGTGGGGTAGGACTCGATGATGGAGCGAAAAAGATGATTCAATCGATTAA
GGAAATTGTGGGTAATCACTCCGATGCCGATATTTACACTGCCTTAAAAGAAGCTAACATGGACCCTGACGAGGCTGTGC
AGAAGCTGATTCATCAAGATCCATTCCACGAGGTGAAGAGAAAAAGAGACAGGAAGAAAGAGGATACAGTAGTTGTTGAG
CCGGCCAACAGAAAGAAACCTCTTGAAAGTGTTACCAGTGAAGTAAAAGTTCGTACACAGCCTGAATATAATGTTAGGAG
AGGAGGCTACCATAGAAATTTCGTCCCCAGGAATGCTGCTCAACGGAATGCATTTCCTAGGAATCCTGCTACTGGATCCA
ACAGAGAGTTTCGTGTTGTTAGGGACAACAGGTCTAATCCAAATGTTGATGAAGAGTTGAAACATTCATCTGGATCAAAT
ATTAACAAAGTGGTGGCCACTGTGAACAAAAAGGGCTCAACAAGTGGTTTGGACAATCATGACTCTTCTGGGGCTCAAGA
TGTTACTGACGATCGTAATACAGCAGCAGATGTCAGGCCCAGGCAGCCTGAAATCGCTCCTTTGCACCGTCCTACGAATA
AAGGATTCTCTGATGGAAAGCAGACAGTTGGTGGAGTTACTTTGCCACCAACCAATTCAGTTCTTGGTGTATATGCGTCT
TCCACAGATCCAGTTCATGTACCATCTCCTGTTTCTAGATCATCACCAGTGGGAGCTATTAAACGTGAAGTAAGGGGTGG
TGGTTTTGGAAAGCCTTCTGAAAATGTTGGTAAAGAGCCATCTGTCCGATCTTTTCCAGGGTCCACTATTAGAAAAAATG
GGCCTCCAAATGCATATCGGCCATCTTCCCCAACGCCAAAGATTGATCACAGTCAAACTACTGCACGAGAGCCTAATATG
CCCAGCGGTGTGGAAAAGAGTAGGTCATTTCTTAACAGACAGCGTGGGAATAGAGGAAGCCAATATGCCAGAACACAACA
AGTTGGTGGCCATACAAAGGGAGTCTCTCAGAACAAGGAGTGGAAGCCAAAATCAACTCAGAAACCTGTTGGACATAACC
CTGGAGTAATTGGAACACCTACAAAGTCTCAAGCTCGTCGGCCTGCTGATAATTCCATAAACGTGGAATCAGAAGCCGTT
GAGTTGCAAGATAAGCTTTCGCATGTTCATATCAGTGAAAGTCAGAATGTCATCATCGCAGATCATATTCGCATCCCGGA
GACTGACCGCTGTCACCTGACTTTTGGTAGCTTTGTTCAAGAGTTCGATTCGTCTAGGAATTCAGCTTCTGCTATTCAAG
AATCATGCTCTTTAGAAGAACTTAGAGATTCTGATCATAGTTTGCCAGTTTCTTGCCCTGAAGCTTCAACAGATGGTCCG
GACGTTCAGCCTATCAATATTCTTGATGATCATGTCAGAATTTCTGCGTCTGAGTCACCCGTCTCACCAGTATCTGAGCC
ACAATTACCCGAACAGAAAGAAATTAATAGATCTGATAATCTGGATGAGTACTCAGGAGTCCAATCACTCAATAGGAATG
GTCCACCTTATACTCCTTTACAGTTTGAACAGCAGCAAGATCCTCCCGAGTTGCAAAAATTCTCTGCATATGATCATCAT
GGTGGTTATGAATTTCCTTATTTTAATCCTGCAACCGATGAAACTATGCGAGGTCAAGGATTACCATCTCCACAGGAGCA
GGTATTAAGTACTCACATGGTGAATAATGCCCCTCCATCTACTATTCCCATGTTGCAGCAACAACAACAGGCATCAATGC
AACAGATGTATCCACAGGTTCATGTTTCACATTATCCCAATCTCATGCCTTATCGCCAGTTCCTCTCCCCATTCTATGTA
CCCCAGGTACCCATGACAGGGTACTCAGGTAACCCGGCAGCATATGCACACCCTTCAAATGGAAATGGCTATGTATTGAT
GCCTGCAGGCGGTTCAAATGGTGTCAAGTATGGGATCCATCAGCAATTCAAACCAGTTGCAACAAGTGGGCATACGGGTT
TTCAGACGTACAACAATCCTAGTGGGTATCCAATGAATTCTCCCAATGTAGTTGGAAACGCTACAGGGCTTGAAGATTCA
TCTCGCATGAAATACAAAGATGGAAATATCTACACTCCAAATCCTCAGTCTGAGACTTCTGAGATTTGGATGACAAATCC
AAGAGATCTTTCAAGCCTTCAGTCTCCTCAATATTACAACGTAGCTGGACAAACGCCTCATGGTACTTATTTATCATCCC
ATACAGCACATCCATCCTTCAACGCCGCTGCAGGAGCAGCACAACCATCTCACATGCAGTTCCAGGGTCTCTTCCACCCG
CCACAGCCAGGTACAATGGCGAATCAGCATCATATGGGACCTGGGCTTGGTGGTAATGTTGGAGTTGGGGTCGTGCCCTC
TCCGCCTCCGTCTCAAGTTGGTACCTATCAGCAATCACAGATTGGTCATCCGAATTGGCCAGCAAACTTCTGA