Details for Capsella Locus Carubv10012959m

Position : scaf_3 ( 5`- 2144877 .. 2152197 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012959m

Protein [Map View]
MGAPEKSQSNTNSMQRVKVYHLNEDGKWDDRGTGHVSIDYVERSEELSLCVIDEEDNETLLVHPINPEDIYRKQEDTIIS
WRDPERSTELALSFQETAGCSYVWDQICTMQRNLHFSSLNSETFHSLNSELRELPAVELTTLPLILKIVTESGITDQMRL
TELILKDHDFFRNLMGVFKICEDLENVDGLHMIFNIVKGIILLNSSQILEKIFGDELIMDIIGCLEYDPGVPHSQHHRNF
LKEHVVFKEAIPIKDPLVLSKIHQTYRIGYLKDVVLARVLDDAIVANLNSVIHANNAIVVSLLKDDSTFIQELFARLRSP
SLSMESKKNLVYFLHEFCSLSKSLQVVQQLRLFRDLITEGIFHVIEEVLQIPDKKLVLTGTDILMLFLTQDPNLLRSYVV
RTDGNPLLGLLVKGMMEDFGDRMHCQFLEIIRTLLDANALSGGAQRANIMDIFYEKHLPELVDVITASCPEKSGNTSEGA
ARRIFTKPEVLLNICELLCFCIMQDASRTKCSFLQNTVTEKVLHLTRRKEKYLVVAAVRFVRTLLSVHDEYVQNYVVKNN
MLKPIIDVFIANGNRYNLLNSAVLDLLEHIRKGNATLLLKYIVDTFWDQLAPFQCLTSIQAFKVKYEQCLESAGPKSTAD
AVDPRRRVDERALEKEEEDYFNEDSDEEDSASASNTQKEKPTSNTEKEQPKPHLSNGVAVSPTSSSPRSGGLVDYEDDED
DEDYKPPPRKQPEVSEDEEGELLSLKRKSDCVEKEQEPSKKPRLGKSSKRENVFAVLCSTLSHAVLTGKKNPGTTGSAAR
SIVAKGAEDSRSSEENNSSSSDDENHKDDGVSSAEHGTSDNGKLNGEESLVVAPKSSPEMAVNGS*

DNA
ATGGGCGCCCCGGAAAAGTCGCAATCTAATACCAATTCGATGCAGAGAGTGAAGGTCTATCATTTGAATGAAGATGGTAA
ATGGGATGATCGAGGAACTGGGCATGTAAGCATCGACTATGTGGAGCGATCAGAAGAACTTAGTCTATGTGTAATTGATG
AAGAAGATAACGAGACGTTACTTGTGCATCCCATCAACCCTGAGGACATTTACAGGAAGCAAGAAGACACTATAATCTCA
TGGAGAGACCCGGAGCGCTCAACAGAACTGGCTTTAAGCTTTCAAGAGACTGCGGGATGCTCTTATGTGTGGGATCAAAT
ATGCACTATGCAACGAAATTTGCATTTCAGCTCTTTGAACAGCGAAACATTTCACAGCCTGAATAGTGAGTTGAGGGAGC
TTCCTGCTGTAGAGCTTACTACTCTTCCCCTAATACTGAAGATCGTTACAGAGAGTGGCATTACAGATCAGATGCGGCTT
ACTGAACTTATTTTGAAGGATCATGATTTCTTCCGGAATCTGATGGGTGTGTTTAAAATATGCGAGGACTTGGAAAATGT
TGATGGCCTTCACATGATATTTAACATTGTCAAGGGAATCATTTTGCTGAATAGTTCTCAGATCTTGGAGAAAATATTTG
GAGATGAACTGATTATGGACATTATCGGATGCCTTGAATATGACCCCGGAGTTCCTCACTCCCAGCATCACCGGAATTTT
CTGAAAGAGCATGTTGTCTTTAAGGAGGCTATACCAATCAAGGATCCGTTAGTCCTGTCAAAGATACACCAAACGTACAG
AATTGGTTACTTGAAGGATGTTGTTCTGGCTAGAGTACTAGATGATGCTATAGTTGCAAACTTGAATTCAGTAATCCATG
CAAACAATGCCATTGTTGTTTCATTGCTGAAGGATGATAGTACTTTTATTCAAGAGTTATTTGCGAGGTTGAGGTCACCT
TCTTTATCTATGGAATCCAAGAAAAATTTGGTATATTTCTTGCACGAATTTTGTAGTTTAAGCAAGAGCCTCCAGGTGGT
GCAGCAGCTGCGACTATTTAGGGACCTTATTACTGAAGGAATTTTTCATGTCATAGAAGAAGTCCTGCAGATTCCGGACA
AAAAACTTGTATTGACTGGTACAGATATCCTGATGCTTTTCTTGACTCAAGACCCCAACCTTTTACGTTCTTATGTTGTT
CGGACAGACGGAAACCCCCTCCTTGGTCTCCTGGTCAAGGGAATGATGGAAGACTTTGGTGATAGGATGCATTGCCAATT
TCTAGAAATTATCCGAACCTTACTGGATGCAAATGCATTGTCTGGTGGAGCTCAGAGAGCGAATATCATGGATATATTTT
ACGAGAAGCACCTACCAGAGTTAGTGGATGTCATTACTGCCTCATGTCCTGAGAAGTCAGGCAACACATCTGAAGGTGCA
GCGAGACGGATTTTCACAAAACCTGAAGTCCTATTGAACATATGTGAATTGTTGTGCTTTTGCATCATGCAAGATGCATC
CAGAACAAAATGCAGTTTTCTCCAAAACACTGTGACTGAAAAAGTTTTGCATCTCACACGGAGAAAGGAAAAATACCTAG
TGGTTGCTGCAGTACGATTTGTCCGTACTCTCCTATCAGTCCATGATGAGTATGTCCAGAATTATGTTGTTAAAAACAAC
ATGCTGAAACCGATCATAGATGTCTTTATTGCAAATGGAAACCGGTACAATCTGCTGAACTCTGCAGTCTTGGATCTGCT
TGAGCATATACGCAAGGGAAATGCAACTTTGTTGCTCAAATACATAGTCGATACATTCTGGGACCAGTTGGCCCCATTTC
AGTGCTTGACCTCCATTCAGGCTTTCAAGGTCAAGTATGAACAGTGTTTAGAAAGTGCCGGACCGAAAAGCACTGCTGAT
GCGGTGGATCCAAGAAGACGAGTTGACGAGCGTGCCTTGGAAAAAGAGGAGGAAGATTATTTCAATGAAGACAGCGATGA
AGAAGATTCAGCCTCTGCTTCTAATACACAGAAGGAAAAACCTACTTCTAATACAGAGAAAGAGCAACCTAAGCCTCACC
TTTCCAATGGAGTGGCTGTAAGCCCTACTTCTTCAAGTCCGAGGTCTGGAGGCTTGGTCGATTATGAAGACGATGAAGAT
GATGAAGACTATAAACCTCCTCCACGGAAACAGCCAGAAGTCTCTGAGGATGAGGAAGGCGAGCTTCTTAGTCTGAAACG
CAAATCCGATTGTGTAGAAAAAGAACAAGAGCCGTCCAAGAAACCGCGGTTGGGTAAAAGTTCAAAAAGGGAAAATGTAT
TTGCTGTGCTATGTTCGACGCTGAGCCATGCAGTTCTTACGGGTAAGAAAAATCCAGGCACCACTGGATCTGCAGCCCGG
TCCATAGTAGCTAAGGGAGCTGAGGATTCGAGAAGTAGTGAAGAGAACAATAGCAGCAGTTCAGATGATGAAAATCATAA
GGATGATGGAGTGTCGAGTGCAGAACATGGGACATCAGATAATGGGAAGCTAAATGGGGAAGAATCTCTTGTAGTAGCTC
CAAAATCATCACCTGAAATGGCTGTAAATGGATCCTGA