Details for Capsella Locus Carubv10012955m

Position : scaf_3 ( 5`- 3727575 .. 3734271 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012955m

Protein [Map View]
MAVSLQRPGLLSSSSSNPCLPRMSIVTFISCKKTVHLEYLSNCWSNPRSQLCIRYGYLEKSKSRLSKKRSQMLVLASAED
RVAINGTPQPRSNSNSREIRASFTGSVESENNCNGLLQSLHDAARTLELAVIEKISPSRFSWFSVTWLGADKNAWVKTLS
YQASLYSLLQAVNEISSRGIYRDEDVNVFVQRSLSRQAALLENMMLDNLSSKHPKAYEWFWSEQIPSIVTYFVNYIEGDQ
RFVAATSVYAKGKSTAASNEVEVSLLMLVLNCIAAIMKVGPAKFSCPPFFSMIPDTTGRLMEKLVDIVPLPQAYHSIKSI
GLQREFLTHFGPRAAGCRVNGDIATDEVVFWVDLIQKQLQRAIDREKIWSKLTTSESIEVLERDLAIFGFFIALGRSTQS
ILAANGFDSLENPLEDLVRHLIGGSVLYYPQLSAISSYQLYVEVVCEELEWIPFYPNDTGPQPPKQSHGHKSKPEGPPNY
EVIPELLDVCSYWLQSFIKYSKWPESPSNVKAAKFLSKGHKTLFQCKEELGILKNASSIVRESNSFDKALESVDEALVRL
ESLLQELYVSNSSSGKEQIKAACSDLEKIRKLKKEAEFLEATFRAKAASLQQGGDKNDSQESYVVQKRYFKGKDTNNAIN
SEDQGKSMSRGFWGFFVRPPRKELNPELSGDEYVGKSSGNLLSIESEPNEISRFEILRNELIELEKRVKRSTDKSVDDEE
IISEDTQRSSRTENVQLVQTPKKENLIEKTLQKLRETTTDVWQGTQLLAIDSAAAMQLLRRSLIGDELTGKEKKALRRTM
TDLASVIPIGILMLLPVTAVGHAAMLAGIQRYVPGLIPSTYGSERLNLLRQLEKIKELQTNETETEEGVEEIAV*

DNA
ATGGCAGTTAGTCTACAGCGACCTGGTCTTCTATCTTCAAGCTCTTCAAATCCATGTCTGCCAAGGATGTCTATTGTAAC
TTTTATATCCTGCAAAAAGACGGTACACTTAGAATACTTATCAAATTGCTGGAGCAATCCTAGGAGCCAGTTGTGTATAA
GATATGGTTATTTGGAAAAGAGCAAAAGTCGTCTTAGCAAGAAGAGGTCACAGATGCTGGTCTTGGCATCTGCTGAAGAT
AGAGTGGCTATCAATGGAACTCCCCAGCCAAGATCTAACAGTAATTCTCGGGAGATAAGGGCCAGTTTCACCGGATCAGT
AGAAAGCGAAAACAACTGTAATGGGCTACTTCAGTCTTTGCACGATGCCGCCAGAACTCTTGAGTTGGCTGTTATAGAAA
AGATTTCTCCGTCCAGATTTTCATGGTTTTCTGTGACCTGGCTAGGTGCTGATAAGAATGCATGGGTGAAGACCCTTTCC
TATCAGGCTTCTCTGTACTCTTTACTACAAGCAGTAAATGAGATTTCATCTAGAGGAATTTACAGAGACGAGGATGTTAA
TGTCTTTGTTCAAAGGAGCTTATCACGCCAAGCTGCTCTTCTTGAGAATATGATGCTAGATAATCTATCTTCAAAACACC
CTAAAGCCTATGAATGGTTTTGGTCCGAGCAAATTCCTTCCATAGTAACATATTTCGTGAATTACATAGAGGGGGACCAA
CGATTTGTTGCTGCCACTTCTGTCTATGCAAAAGGGAAGTCCACAGCTGCAAGTAATGAGGTTGAGGTGTCACTTCTTAT
GCTTGTGCTCAATTGCATTGCAGCAATAATGAAAGTTGGCCCGGCAAAATTTTCCTGCCCACCCTTCTTCTCTATGATTC
CAGATACAACTGGAAGATTGATGGAAAAACTTGTAGACATCGTACCACTTCCCCAAGCGTATCATTCAATCAAAAGCATA
GGCCTACAAAGAGAATTTCTTACTCATTTTGGTCCTCGCGCAGCAGGGTGCAGAGTAAATGGTGACATTGCTACAGATGA
AGTTGTTTTCTGGGTCGATCTCATACAGAAGCAACTGCAGCGGGCTATAGATCGAGAGAAAATATGGTCAAAGTTAACGA
CATCCGAAAGTATAGAGGTTTTGGAGAGAGATTTAGCAATTTTTGGATTCTTCATTGCTTTAGGCAGGAGCACACAGTCT
ATTTTAGCTGCAAATGGTTTTGATTCTTTGGAGAATCCTTTGGAAGACCTTGTTAGGCATCTTATTGGGGGTAGCGTCCT
ATACTATCCTCAACTTTCAGCCATCAGTTCATACCAGCTGTATGTCGAGGTTGTTTGCGAAGAACTAGAATGGATTCCTT
TCTATCCAAATGATACTGGCCCACAGCCTCCAAAACAATCACATGGGCATAAAAGCAAACCAGAAGGGCCACCTAATTAT
GAAGTTATTCCCGAACTATTGGATGTTTGCTCTTATTGGCTGCAGAGCTTTATTAAATATAGTAAATGGCCAGAGAGTCC
TTCTAATGTCAAGGCAGCAAAATTCTTATCCAAGGGGCACAAGACTTTGTTTCAGTGTAAAGAAGAACTGGGGATATTAA
AGAATGCATCATCAATTGTTAGAGAGTCAAACTCATTTGACAAGGCCCTAGAAAGTGTAGATGAAGCCCTCGTGAGACTG
GAAAGCCTGCTACAGGAGTTGTATGTGTCAAACTCATCGTCTGGGAAGGAACAAATAAAAGCCGCTTGCTCTGACCTAGA
AAAAATACGGAAGCTTAAGAAAGAGGCTGAATTTCTGGAGGCAACTTTTAGAGCCAAAGCAGCTTCCTTGCAACAGGGAG
GTGACAAAAATGATTCTCAGGAATCCTACGTGGTACAAAAAAGGTATTTTAAAGGAAAAGACACAAACAACGCAATTAAT
TCTGAGGATCAAGGCAAAAGTATGAGTCGTGGATTCTGGGGGTTCTTTGTGAGGCCTCCAAGGAAGGAGCTTAATCCTGA
GTTATCGGGAGATGAATATGTTGGGAAATCCAGTGGAAACTTACTTAGCATAGAGTCAGAACCAAATGAGATCAGCCGAT
TCGAAATTCTAAGGAACGAGCTGATAGAACTGGAAAAGCGGGTCAAAAGAAGCACTGATAAGTCAGTAGATGACGAGGAA
ATAATCTCTGAGGATACTCAACGAAGCAGTAGAACGGAAAATGTTCAGTTGGTTCAGACTCCTAAGAAGGAAAACTTAAT
TGAGAAAACTCTTCAAAAGCTAAGAGAAACCACCACGGACGTGTGGCAAGGTACTCAACTTCTTGCCATTGATTCAGCAG
CTGCTATGCAGCTACTTAGGAGGTCTCTGATTGGTGATGAATTAACAGGAAAAGAAAAGAAAGCCCTGCGCAGAACCATG
ACTGACTTGGCATCAGTTATTCCCATCGGTATTCTAATGCTTCTTCCTGTCACAGCGGTTGGTCACGCAGCCATGCTGGC
TGGAATTCAGAGATATGTCCCAGGCCTGATTCCTTCCACATACGGGTCCGAAAGGTTGAACTTATTGAGACAGCTTGAGA
AAATCAAGGAACTGCAGACAAATGAAACTGAGACTGAAGAAGGCGTCGAGGAAATAGCAGTATGA