Details for Capsella Locus Carubv10012953m

Position : scaf_3 ( 5`- 2962609 .. 2967416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012953m

Protein [Map View]
MSLVGRVGSLISQGVYSVATPFHPFGGAIDVIVVQQQDGSFRSTPWYVRFGKFQGVLKGAEKFVKIAVNGTEADFHMYLD
NSGEAYFIREVDPAANDANSLISGSENNNGTETKGVGFRLEHSLSDTGVEELREGFDPLNRLERTESDCNRRFYDFQDDP
PSPTSEYGSARFDNLNVENYGDSQGSDSEVVLVSIDGHILTAPVSAAEQEAENLRLNTPQFHLAPGDGTDFCEGNTEFAS
SETPWDTEYISKVESSDTTNIVSEKVATANDGRNDSDSYSRDNSEKDSHDAERKLRGSYLEQSELTETGEISKSEEEGPT
FEDRNLKEGEFPLDTIAENERSEDEVTIETVDTLVDSFESSTTQITTEEVKTTEESRISVDSNADSECRDEQPRTSEEAI
LINSQEVGIIDLEDQASERVSIDSTREDDEQLTPSKPTEEDNEDGKSVVSVGATSTFDVGKPDTDQRYELSICKDELRQG
MGLSAAAEVFDAHRISMEEYVNSATSILESENLVVRIRETYMPWTKAARIVLGKAVFDLDLDIQPDDVISVEENKSPIPK
DDETTITPSSGRRWRLWPIPFRRVKTIEHTGSNSSSEEDLFVDSEPGLQNSPEAQSTTESRHDSPRRQLVRTNVPTNEQI
ASLNLKDGQNIITFSFSTRVLGTQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQFMPFIGKDWTQSGVAKLFSAIKEN
GYQLLFLSARAIVQAYLTRNFLNNLKQDGKALPTGPVVISPDGLFPALYREVIRRAPHEFKIACLEDIRKLFPADYNPFY
AGFGNRDTDELSYRKLGIPKGKIFIINPKGEVATGHRIDVKKSYTSLHTLVNDMFPPTSLVEQEDYNPWNFWKLPIEEVD
*

DNA
ATGAGTTTGGTTGGAAGAGTTGGGAGTTTGATTTCTCAAGGTGTTTACTCTGTTGCCACACCGTTTCATCCCTTTGGTGG
TGCTATTGATGTCATTGTTGTTCAACAACAGGATGGTTCGTTCCGCAGCACCCCTTGGTATGTCAGGTTTGGTAAGTTCC
AAGGTGTTCTCAAAGGCGCTGAGAAGTTTGTCAAGATTGCTGTTAATGGAACCGAAGCCGATTTCCACATGTATCTTGAT
AATTCTGGTGAAGCATATTTCATCAGGGAAGTTGATCCTGCAGCTAATGACGCCAACAGTTTGATTTCCGGGTCTGAGAA
TAACAATGGTACTGAAACTAAAGGCGTGGGTTTTCGACTTGAGCACAGTTTATCTGACACTGGTGTTGAGGAATTACGAG
AGGGTTTCGACCCTTTGAATCGGCTTGAGAGGACCGAGTCTGATTGTAATAGGAGATTTTATGATTTTCAGGATGATCCG
CCTTCTCCAACCTCTGAATATGGAAGTGCTCGGTTTGACAATCTAAATGTGGAAAATTATGGGGATTCTCAAGGCTCAGA
TTCTGAGGTGGTTTTGGTCAGTATTGATGGACATATACTAACGGCCCCTGTGTCAGCCGCAGAACAGGAGGCTGAGAATT
TACGGTTAAATACTCCTCAGTTTCATTTGGCCCCTGGTGATGGAACTGATTTTTGTGAAGGTAATACTGAGTTTGCATCA
TCAGAGACTCCGTGGGATACTGAATATATCAGCAAAGTGGAGTCATCTGACACTACTAATATTGTATCTGAAAAAGTAGC
TACTGCGAACGATGGTCGTAACGATTCAGATTCGTATTCTCGTGATAATTCTGAAAAAGATTCTCATGATGCTGAAAGAA
AACTTCGTGGGAGCTATCTGGAGCAGTCAGAGCTGACTGAGACTGGTGAGATCTCGAAGTCGGAGGAAGAAGGTCCTACT
TTTGAGGATCGGAATCTAAAAGAAGGTGAGTTTCCACTTGATACCATCGCAGAAAATGAAAGAAGTGAAGATGAAGTGAC
TATTGAAACAGTAGATACTCTTGTTGATAGTTTTGAATCTTCTACAACCCAAATAACAACCGAAGAAGTGAAAACAACCG
AGGAATCCAGAATATCCGTTGATTCTAATGCTGATTCAGAATGTAGGGATGAACAGCCAAGAACATCTGAGGAGGCCATC
TTGATTAACAGCCAGGAAGTCGGGATTATAGATTTGGAGGATCAGGCTTCTGAGAGAGTCTCTATAGATTCAACGAGGGA
GGACGATGAGCAACTGACTCCATCTAAACCAACTGAGGAGGATAACGAGGACGGGAAGAGTGTAGTTTCAGTGGGTGCGA
CTTCTACTTTCGACGTAGGAAAACCTGATACAGATCAGAGATACGAGCTATCAATTTGCAAGGATGAGCTTCGTCAGGGT
ATGGGACTCAGCGCAGCTGCTGAAGTCTTTGATGCACATCGGATTTCAATGGAAGAGTATGTAAATTCTGCAACATCAAT
TCTTGAAAGTGAAAATCTGGTTGTTAGGATTAGAGAAACTTATATGCCGTGGACGAAAGCTGCTCGGATTGTGCTTGGGA
AAGCCGTGTTTGATCTAGACTTAGATATCCAGCCTGATGATGTGATTTCTGTGGAGGAAAATAAATCGCCTATACCCAAG
GATGATGAAACTACAATAACTCCTTCATCTGGAAGAAGATGGAGACTTTGGCCTATTCCTTTTAGAAGGGTTAAAACAAT
TGAGCATACGGGAAGTAACTCCTCAAGCGAAGAAGATCTGTTTGTTGATTCCGAACCTGGCTTACAGAACTCACCGGAAG
CACAATCAACCACAGAGAGTCGCCATGACTCCCCACGTAGACAACTTGTGAGAACCAATGTCCCTACCAATGAACAGATC
GCATCTCTGAATCTGAAAGATGGTCAGAATATAATAACTTTTAGTTTCTCAACAAGAGTTCTTGGAACACAACAGGTCGA
TGCACATATTTACCGGTGGAGATGGGACACCAAAATAGTGATTTCAGACGTCGATGGAACTATAACTAAATCTGATGTGT
TAGGTCAGTTCATGCCCTTCATTGGAAAGGACTGGACACAATCTGGTGTAGCCAAGCTTTTCTCTGCCATAAAGGAGAAT
GGATATCAGTTGCTCTTTTTGAGCGCTCGTGCCATCGTTCAGGCATATCTAACGAGAAATTTCTTAAATAATCTGAAGCA
GGACGGAAAAGCTCTGCCCACCGGTCCTGTAGTCATTTCACCAGATGGGCTGTTTCCAGCATTGTATCGCGAAGTTATAA
GAAGAGCACCTCATGAATTCAAGATTGCATGTTTGGAGGATATCAGGAAACTCTTCCCTGCAGATTACAACCCGTTCTAC
GCTGGATTTGGAAACAGAGATACCGATGAGCTGAGTTACAGAAAACTGGGAATCCCAAAGGGGAAGATATTCATAATCAA
CCCAAAGGGAGAAGTGGCAACAGGACATCGCATAGATGTCAAAAAGTCTTACACTTCACTTCATACTCTTGTCAACGACA
TGTTCCCTCCAACTTCACTTGTTGAGCAGGAAGATTATAACCCATGGAACTTCTGGAAACTACCAATAGAAGAGGTTGAT
TAA