Details for Capsella Locus Carubv10012950m

Position : scaf_3 ( 5`- 2435911 .. 2440023 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012950m

Protein [Map View]
RTEEELSSSLHFNTSIVVVPFPLRLFHPEIVRNCRTHKLSNKTPKMDIFSYVILLSCASSPLSYASPASFSRRHLLQTPP
TDPSTFSPPFFPLYSSSSPPPPPPQPLPPPAPTFATFPANISALVLPRSPQSHTPSRTLLIPVISAVLAVAALLGLSLFL
YGRWRGQTRHFKEDSKTLAPSSDISPSGQQTPQCPPPRNNTTENKLSVAPSTSDVLYLGNVAASSGSVFVKPASPEISPL
PPLPARSFLLQHNSEANLDGEEEDDDFYSPLASIAGQEPRDRRINPYSNCSCSISSHSDSPAMSPSATISPPMNSTAPHW
STNQNPQSLSSPERTTRNNKRYGGSSLRMFSLWNQSLGFPRISSASTSPERGMTRTPDAYARSSMYSSVATTPDRFFRKV
LDSSPPRWNDFSRNVKSLFLSSTSASPARDFCINISESSRSLKSSWENPELATTEQSESAAAATLPPPQRPPPAMPEPPP
LVPPSQSFMVQKSGKKLSFSEIPQSCWEGTTERPKPKLKPLPWDKVRPSSRRTTTWDRLPYNPSNANSKQRSLSCDLPML
NQESKVLDPRKSQNVAILLTTLKLTTNDVCQALRDGHYDALGVELLDSLARVVPSQEEEKKLISYSNDSVIKLAPSERFL
KELLNVPFVFKRVDALLSVASFDSKVKHLKRSLRVIQAACEALRNSRMLVRLVGAVLETGMKSGNAHAFKLEELLKLVDI
KSLDGRTSILHSVVQNILESEGIKGLQVVRNLSSVLDDVKKSAEWDYGVLRSDVATLYQGVQKIGEVLLLCEETGHSEEH
HWWKFRESMTQFLETVAEEIKKIEREEASTLIAVKKITEYFHVDSAKEEAQLLKVFVIVRDFLNVLDGVCKKMEETREEA
TLA*

DNA
AGAACTGAAGAAGAGCTCAGCTCATCACTACACTTTAACACTAGCATAGTAGTAGTACCATTTCCATTAAGGCTCTTTCA
TCCTGAGATAGTGCGCAATTGCAGAACACACAAACTCTCCAACAAGACCCCAAAAATGGACATCTTCTCCTACGTCATCC
TCCTATCATGCGCGTCCTCCCCCTTATCTTACGCCTCTCCGGCCAGTTTCAGTCGCCGTCACCTTCTTCAAACTCCTCCA
ACTGATCCTTCCACATTTTCCCCGCCCTTCTTCCCACTTTACAGCTCCTCCTCCCCTCCTCCTCCGCCACCGCAGCCTCT
TCCGCCTCCCGCCCCCACTTTCGCCACATTTCCGGCGAACATCTCCGCCCTCGTCCTCCCTCGCTCTCCTCAATCTCACA
CTCCTTCCCGTACACTCCTTATCCCAGTTATCTCCGCCGTGCTCGCCGTCGCAGCATTACTCGGCCTGTCTTTGTTTCTC
TACGGACGCTGGCGAGGGCAAACCCGTCATTTTAAAGAAGACTCCAAGACCTTAGCTCCTTCTTCAGACATTAGCCCATC
CGGACAGCAAACTCCTCAATGTCCCCCTCCAAGAAACAACACCACTGAAAACAAACTCTCAGTGGCTCCTTCCACCTCCG
ATGTTCTCTACCTCGGCAACGTCGCCGCTTCCTCCGGTTCTGTTTTCGTTAAACCGGCGTCACCGGAGATCTCTCCTCTC
CCGCCATTACCTGCTCGTAGCTTCCTCCTACAACACAACTCTGAAGCTAATCTTGATGGAGAAGAAGAAGACGACGACTT
TTACTCGCCTCTCGCGTCCATAGCTGGTCAAGAACCACGAGACCGGAGAATCAATCCGTACAGCAACTGCTCTTGCTCTA
TCTCTTCACACTCGGATTCTCCGGCAATGTCGCCGTCCGCTACGATTTCTCCGCCGATGAACTCTACAGCTCCACATTGG
TCAACTAACCAAAACCCTCAGTCTCTGTCGTCACCGGAGAGAACAACAAGGAACAATAAGAGATATGGTGGTTCGTCTCT
GAGAATGTTTAGCCTCTGGAATCAAAGTCTAGGGTTTCCAAGAATTTCTTCTGCTTCTACTTCACCAGAGAGAGGTATGA
CTAGAACTCCTGACGCATATGCTCGTTCTTCTATGTACTCTTCAGTGGCCACCACGCCGGATCGATTTTTCCGGAAGGTT
CTTGATAGTTCGCCGCCGAGATGGAACGATTTCAGTCGAAATGTTAAGTCTTTGTTCCTTTCTTCAACTTCTGCTTCACC
AGCTAGAGATTTCTGTATCAACATCTCTGAATCTTCAAGAAGTTTGAAATCTTCTTGGGAAAATCCAGAGCTTGCTACAA
CTGAACAGAGCGAATCTGCCGCTGCTGCTACTCTTCCGCCTCCACAACGGCCACCGCCCGCAATGCCGGAGCCTCCTCCT
CTTGTGCCGCCGTCACAGTCTTTCATGGTTCAGAAATCTGGGAAAAAGCTATCTTTCTCCGAGATACCACAGAGTTGCTG
GGAAGGAACGACAGAGCGGCCAAAGCCAAAGCTGAAACCTCTGCCTTGGGACAAAGTCCGACCAAGTTCTCGCCGGACAA
CTACATGGGATCGTCTTCCCTACAACCCTTCAAATGCTAACTCAAAGCAGAGAAGTCTTAGCTGTGATCTTCCGATGCTA
AATCAAGAGAGCAAAGTTTTAGATCCAAGAAAGAGTCAAAATGTTGCTATTCTTCTTACAACACTTAAGCTCACCACAAA
TGATGTTTGTCAGGCCCTTCGAGATGGTCACTATGATGCACTTGGAGTTGAGCTTCTTGATAGTTTAGCAAGAGTGGTAC
CGAGCCAAGAAGAAGAGAAGAAGTTGATTAGCTATAGTAATGATTCAGTGATCAAGCTTGCCCCATCAGAGAGGTTCCTC
AAGGAATTGTTAAATGTGCCTTTCGTGTTCAAACGAGTTGATGCATTGCTCTCTGTTGCTAGTTTTGACTCTAAAGTCAA
ACACTTGAAAAGATCACTACGAGTTATACAGGCTGCTTGTGAGGCACTTCGAAATAGCAGAATGTTAGTGAGACTTGTTG
GAGCTGTCTTAGAGACAGGAATGAAGAGCGGGAATGCTCACGCCTTCAAACTTGAGGAGCTGCTCAAGCTTGTCGATATC
AAATCGTTAGATGGAAGAACCAGTATCTTGCATTCTGTTGTACAGAACATCTTAGAATCAGAAGGTATCAAAGGGCTACA
AGTTGTGAGAAATCTGAGTTCAGTACTTGACGATGTCAAGAAATCTGCAGAGTGGGACTATGGCGTTCTAAGAAGTGATG
TGGCGACGCTTTACCAAGGAGTTCAGAAAATTGGTGAGGTTTTGCTATTGTGTGAGGAGACAGGACACAGTGAGGAACAC
CATTGGTGGAAATTCAGGGAGTCGATGACCCAATTCTTGGAGACCGTTGCTGAGGAAATTAAAAAGATAGAAAGAGAAGA
AGCTTCCACGCTCATTGCAGTGAAAAAGATCACAGAGTATTTTCATGTAGATTCAGCAAAGGAAGAAGCTCAGCTATTGA
AAGTATTTGTAATCGTGAGAGACTTTCTGAACGTTCTAGATGGAGTCTGCAAGAAAATGGAGGAGACTAGAGAAGAGGCT
ACTCTGGCTTAG