Details for Capsella Locus Carubv10012949m

Position : scaf_3 ( 5`- 4356774 .. 4361041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012949m

Protein [Map View]
MGKRKERRFASMSSTGRRVKLDLFAEPSGDLGGSDMRDGVEREKREPNELPNSPSSSGQKTENPLLLLGQYSDDEVEEDA
TADSSLANKNEQVDGLLEEGPKDTNINSGADTTMQMADLQTGEDPSSLDFQAEGDSGFVTVNNSTILDGLNKQTVASVQT
SGSMSLELHAPTGVTSQWKTILHEESNQYYYWNTETGETSWEIPAVLTQTASAYGTCYNESGPMVTDGSTLISGVEPSYL
LPAQNSFTGTDCSTFSTVALDERNKSEDLYVKSLGTDGQLECRIEPIVNIQPCQEDLARTENADHVHTNFDKEAVTDLSS
RLLSQSEGLLEKLRSLKRSHGNFHSNEQISKYILEVEVRHSDVKALILETSPLLAFWLHTEKQLKRLEDSINDEIYQLAK
SAVMDEIAETNKSPPKEKLVADANTESESEDSGREGVLAQSGKSLHLDESADVSGNGSPKHSRSHPAGQSDIIPSTEKAG
SPDVEDIDMDVDMEVEESVPVSSVQVIDASDGKMFRTEPSNLQTDVPPPPGEEWIPPPPSESEDVPPPPPDSYGEPIPPP
PENGDVPSFPSDSLGVPYTVPQCYMQQSTDYATQYNLSYPGPNYQYTANAVAPDSNTQFYGHVDGSQVSFPQSTFYYETV
PGTSEVTPAAANVGEAYYNLNGVAPLFPVISSVQSSLHHNGVGSANYNIPSNSSTVVVPSLRTSDSAGIASSGTASQSTD
VTGGSSLLTRGQTKVKRTKKRTVAATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDYGILDRKRQREIEEWKSRQIAS
GEAKDNANFQPLIGDWREKVKRKKERAEKKSQKKDEEKQQKPDLSKISANLPSGWQAYWDESTKKVYYGNTSTSQTSWTR
PTT*

DNA
ATGGGGAAGAGAAAAGAGCGTCGTTTCGCCTCCATGAGTAGCACCGGCCGTCGTGTCAAGCTTGATCTCTTTGCGGAACC
CTCTGGAGATTTGGGTGGCTCAGATATGCGTGATGGAGTTGAGCGGGAAAAAAGAGAGCCCAATGAGTTACCCAATTCAC
CTTCTTCTTCAGGTCAGAAAACAGAAAACCCTTTGCTTTTACTTGGGCAGTATAGTGATGATGAGGTGGAAGAAGATGCT
ACTGCAGATAGTTCTTTAGCCAATAAAAATGAGCAGGTTGATGGATTACTTGAGGAAGGACCCAAAGATACAAATATCAA
TTCAGGTGCAGACACCACTATGCAGATGGCTGACCTGCAGACAGGGGAGGATCCTTCTTCACTTGATTTTCAAGCTGAAG
GAGATAGTGGTTTTGTCACAGTGAATAACTCAACAATCTTGGATGGACTAAACAAGCAGACAGTTGCTTCAGTTCAAACA
TCTGGCAGCATGTCTTTGGAGCTCCATGCTCCCACAGGTGTTACTTCGCAGTGGAAGACGATTTTGCATGAGGAGAGCAA
TCAGTATTATTACTGGAATACAGAAACTGGGGAAACTTCGTGGGAAATTCCTGCAGTTTTGACTCAAACTGCCAGTGCGT
ATGGGACATGCTACAATGAGTCTGGACCCATGGTTACAGATGGGTCCACCTTGATATCTGGTGTTGAACCAAGCTATTTG
CTACCCGCACAAAATAGTTTCACAGGAACTGACTGTTCGACGTTTTCAACTGTTGCTCTGGATGAGAGAAACAAAAGTGA
AGATCTATATGTCAAAAGTTTAGGAACTGATGGTCAACTTGAATGTCGGATAGAACCTATTGTTAACATCCAACCATGTC
AGGAGGACCTTGCAAGGACAGAAAATGCAGATCATGTGCATACTAATTTTGATAAAGAAGCGGTTACTGACCTCTCATCT
CGCTTGTTGAGTCAGAGCGAAGGCTTACTGGAGAAGCTGAGGTCTCTGAAGAGGTCCCATGGAAACTTTCACAGCAATGA
GCAGATATCAAAGTACATTCTAGAGGTTGAAGTCAGACATTCTGATGTTAAGGCGCTCATATTGGAAACCTCACCTTTAC
TTGCTTTTTGGCTTCACACTGAGAAACAACTTAAGCGTCTCGAAGACAGTATTAATGATGAGATTTACCAGCTCGCAAAA
TCTGCAGTAATGGATGAAATTGCAGAGACTAACAAAAGCCCTCCAAAAGAAAAGTTGGTAGCAGATGCTAATACAGAAAG
TGAATCTGAGGACAGTGGTAGAGAAGGAGTGTTAGCTCAATCTGGAAAATCTCTTCATTTAGATGAATCAGCGGATGTGA
GCGGCAATGGATCTCCTAAACACTCCCGAAGTCATCCAGCTGGGCAGTCTGATATTATTCCTTCAACTGAGAAGGCTGGC
TCTCCAGATGTTGAAGATATTGACATGGATGTTGATATGGAGGTTGAAGAATCAGTTCCAGTGTCTTCTGTTCAAGTGAT
AGATGCTTCTGATGGTAAAATGTTCAGAACAGAGCCATCTAACCTTCAAACAGATGTTCCACCTCCTCCAGGTGAGGAAT
GGATTCCGCCACCGCCGTCTGAGAGTGAAGATGTTCCTCCACCGCCACCAGACAGTTATGGTGAACCAATTCCTCCACCA
CCTGAAAATGGCGATGTACCATCCTTTCCCAGTGACTCTCTGGGAGTACCCTACACCGTACCTCAATGTTATATGCAGCA
ATCTACTGATTATGCTACACAATACAACTTATCCTATCCAGGGCCCAATTATCAATATACTGCGAATGCTGTTGCTCCAG
ATTCTAACACTCAGTTCTATGGCCATGTTGACGGATCGCAGGTTTCTTTTCCCCAGTCGACATTTTACTATGAAACTGTT
CCTGGGACAAGTGAAGTTACTCCTGCAGCAGCCAATGTCGGTGAAGCTTATTACAATTTGAATGGTGTAGCTCCGCTGTT
TCCTGTCATTAGCTCCGTGCAGTCATCATTGCATCACAATGGAGTTGGTTCTGCTAATTACAACATCCCAAGCAATTCTT
CTACAGTTGTAGTGCCTAGTTTGAGAACAAGTGACTCTGCTGGGATTGCATCTTCGGGAACTGCTTCTCAATCCACAGAC
GTTACAGGTGGATCGTCTCTATTAACAAGAGGTCAAACTAAAGTGAAACGGACTAAAAAGCGGACAGTAGCTGCTACATC
CACATTGAGGTCAAATAAAAAGGTTTCGAGTTTGGTTGACAAGTGGAAAGCTGCGAAAGAGGAGCTAAATGATAGTGAAG
AAGAAGAAGATGATTACGGAATCCTAGATAGAAAAAGACAACGAGAAATCGAAGAATGGAAATCCCGACAAATTGCTAGT
GGAGAGGCTAAAGACAACGCAAATTTCCAACCACTCATTGGTGACTGGCGTGAGAAAGTGAAACGGAAGAAAGAACGAGC
CGAGAAGAAGTCTCAGAAGAAAGACGAAGAGAAGCAGCAAAAACCTGATCTAAGCAAAATCTCAGCAAATCTCCCCTCTG
GATGGCAGGCGTACTGGGACGAATCTACCAAAAAAGTGTACTATGGGAATACAAGCACATCTCAAACCAGTTGGACACGA
CCCACTACCTGA