Details for Capsella Locus Carubv10012948m

Position : scaf_3 ( 5`- 877119 .. 879968 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012948m

Protein [Map View]
MQTTGVSSSSFISKALSSSSNLNELRRVHALVISLGLDGSDFFSGKLIHKYSHFREPASSLSVFRRVSPAKNVYLWNSII
RAFCNNGLYPKALEFYGKLRDSKVSPDKYTFPSVVKACAGLFDAETGDLVYEQILEMGFESDLYVGNALVDMYSRMGLLG
RARQVFDAMPVRDLVSWNSLISGYSSHGYYEEALEIYNELKKYWIVPDSFTVSSVLPAFANLLVVKQGQGLHGFVLKSGV
SSVVVVDNGLLAMYLKFSRPTDARRVFDEMAVRDSISYNTIICGYLNLEMHEASVRIFLENLDQFKPDILTASSILRACG
HLRDLGLAKYVHDYVLRAGFKLDTTVKNILIDVYAKCADMVTARDVFKSMECKDTVSWNSIISGYIQNGDLSEAMKLFRL
MMIIMEEQADHITYLMLISVSTRLADLKFGRGLHSNVMKSGINFDLSVGNSLIDMYAKCGEVGDSLKIFNSMETRDTVTW
NTVISACVSSGDFATGLQVTTQMRKSEVVPDMATFLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQVGNALIEMYSKC
GCLESSFRVFAHMSRRDIVTWTGMIYAYGMYGEGEKALKTFADMEKSGIVPDNVVFIAIIYACSHSGLVEEGLACFEKMK
THYKIDPMIEHYACVVDLLSRSQKISKAEEFIQTMPIKPDASIWASVLRACRTSRDMETAERVSRKIIELNPDDPGYSIL
ASNAYAALRKWDKVSLIRKSLNDKLIRKNPGYSWIEIGKIVHVFRAGDISAPQSEAIHKSLEILYSLMAKEGYIPNSKEV
PQNLQEEEKRHLICGHSERLAIGFGLLNTEPGTPLQVMKNLRVCGDCHEVTKLISKIVGREILVRDANRFHLFKNGTCSC
KDRW*

DNA
ATGCAGACTACAGGAGTGTCATCATCGTCTTTCATCTCTAAAGCTCTTTCATCGTCATCTAACCTCAATGAGCTTCGTCG
AGTCCACGCCCTTGTGATCTCTCTCGGTCTTGACGGCTCCGACTTCTTCTCCGGCAAGCTTATCCACAAGTACTCTCATT
TTCGTGAACCTGCCTCTTCCCTCTCTGTTTTCCGGCGAGTTTCTCCGGCCAAAAATGTTTACCTCTGGAATTCTATCATC
AGAGCTTTCTGTAATAATGGTTTATACCCTAAAGCCCTCGAATTTTACGGAAAACTCCGGGACTCCAAGGTTTCGCCTGA
TAAGTACACGTTTCCTTCGGTTGTCAAAGCCTGCGCAGGATTGTTCGATGCGGAGACGGGAGATTTGGTTTATGAACAGA
TATTGGAGATGGGTTTCGAATCGGATTTATATGTAGGCAATGCACTTGTGGATATGTATTCGAGAATGGGATTGTTGGGT
AGAGCACGACAAGTGTTCGATGCTATGCCCGTGAGAGATCTTGTGTCCTGGAACAGTTTAATTTCTGGCTATAGTTCTCA
TGGTTACTATGAAGAAGCCCTGGAGATTTATAATGAACTGAAAAAATATTGGATTGTGCCAGATTCCTTCACGGTTTCAA
GTGTTTTGCCCGCCTTTGCGAATTTGCTGGTTGTTAAACAAGGACAGGGACTTCATGGTTTTGTTCTCAAGTCAGGTGTT
AGTTCCGTTGTGGTGGTTGACAATGGACTACTTGCAATGTACTTGAAATTTAGCAGACCAACAGATGCAAGACGAGTTTT
TGATGAGATGGCTGTTCGGGATTCCATTAGTTACAATACTATAATCTGCGGATATCTCAACTTAGAGATGCATGAAGCAT
CTGTGAGGATATTCTTGGAAAATTTGGATCAGTTCAAGCCAGATATCTTAACAGCTAGTTCTATTCTCCGTGCCTGTGGA
CACTTACGGGACTTGGGCTTAGCAAAGTACGTTCATGACTATGTGTTGAGAGCTGGCTTTAAGCTTGACACTACTGTTAA
AAACATTCTAATTGATGTGTATGCAAAGTGTGCTGACATGGTCACAGCAAGAGATGTTTTCAAGAGCATGGAATGCAAGG
ATACTGTTTCGTGGAACTCGATAATCAGTGGATATATACAAAACGGAGATCTTTCAGAAGCCATGAAACTCTTTAGGTTG
ATGATGATCATCATGGAAGAGCAAGCGGATCACATCACTTATTTGATGCTTATATCTGTCTCCACGCGTCTTGCAGACTT
GAAATTTGGGAGAGGGCTACACTCGAACGTGATGAAATCAGGAATTAATTTCGATCTTTCTGTTGGTAATTCATTGATTG
ATATGTATGCAAAGTGCGGGGAAGTAGGAGATTCACTGAAGATATTCAATAGTATGGAAACTCGGGATACAGTGACATGG
AACACGGTTATTTCAGCCTGTGTTAGTTCTGGGGATTTTGCAACCGGTTTGCAAGTAACTACTCAAATGAGGAAGAGCGA
AGTGGTGCCTGATATGGCTACTTTCTTAGTTACATTGCCTATGTGTGCTTCACTTGCTGCAAAACGACTAGGCAAGGAGA
TCCATTGTTGTCTGTTAAGGTTTGGATATGAATCTGAGTTGCAAGTAGGTAATGCACTAATTGAAATGTACTCAAAATGT
GGTTGTTTGGAGAGTTCCTTTAGAGTCTTTGCACATATGAGTAGAAGAGATATTGTAACATGGACAGGGATGATCTATGC
ATATGGAATGTATGGCGAAGGTGAGAAAGCTCTTAAAACTTTTGCTGATATGGAAAAATCCGGTATTGTTCCCGATAATG
TTGTCTTCATTGCCATCATCTATGCTTGCAGCCACTCTGGTTTGGTAGAAGAAGGCTTGGCTTGCTTTGAGAAGATGAAA
ACTCACTACAAAATTGACCCGATGATAGAACACTACGCGTGTGTAGTTGATTTGCTGTCCAGGTCTCAGAAGATTTCGAA
AGCCGAAGAATTTATCCAAACAATGCCGATAAAACCTGATGCGAGCATATGGGCATCTGTGCTAAGAGCTTGTCGAACAA
GTAGGGACATGGAAACCGCAGAAAGAGTGTCTAGGAAGATCATTGAACTGAATCCGGATGATCCAGGTTACTCGATTCTA
GCATCAAATGCGTATGCCGCATTGAGAAAATGGGACAAAGTGAGCCTAATCCGCAAATCCTTGAATGATAAACTCATCAG
GAAGAATCCGGGATATAGCTGGATAGAAATTGGTAAAATAGTTCACGTGTTCCGTGCAGGAGATATTTCAGCACCTCAGT
CGGAAGCCATCCATAAGTCGCTAGAGATACTTTACAGTCTCATGGCTAAAGAAGGGTACATACCCAATTCAAAGGAAGTG
CCGCAGAATCTACAGGAAGAAGAGAAGAGACATTTGATCTGTGGGCACAGTGAGAGGTTAGCAATTGGGTTTGGGCTGCT
GAATACAGAACCAGGGACACCGTTGCAAGTGATGAAGAACCTTCGTGTCTGTGGTGATTGTCATGAAGTCACAAAGTTGA
TATCGAAGATCGTGGGGCGTGAGATATTAGTGCGGGATGCTAATCGGTTCCATCTCTTCAAAAACGGAACTTGTAGCTGC
AAAGATCGGTGGTGA