Details for Capsella Locus Carubv10012947m

Position : scaf_3 ( 5`- 2217260 .. 2220891 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012947m

Protein [Map View]
MRMLLRPGIIFHTYTQSSCAVTVCKPLSSLSDNGENHEKPYTFEGNMQIVNEICNVLETSPWGPSAETALSALSFKPQPE
FVIGVIRRLKDVNRAIEYFRWYERRTELPHCPESYNSLLLLMARCRNFDALEQILGEMSVAGFGPSVNTCIEMVLSCVKA
NKLREGFDVVQLMRKFKFRPAFSAYTTLIGAFSAINHSDMMLTLFQQMQELGYEPTVHLFTTLIRGFAKEGRVDSALSLL
DEMKSSSLDADIVLYNVCIDSFGKVGKVDMAWKFFHEIEANGLKPDEVTYTSMIGVLCKANRLDEAVEMFEHLEKNRRVP
CTYAYNTMIMGYGSAGKFDEAYSLLERQRAKGSIPSVIAYNCILTCLRKMGKVDEALRMFEEMKKDAAANLSTYNILIDM
MCRTGKLDYAFKLRDSMQKVGLFPNVRTVNIMVDRLCKSQKLDEACAIFEEMDYKVCTPDEITFCSLIDGLGKVGRVDDA
YKIYEKMLDSDCRTNSIVYTSLIRNFFNHGRKEDGHKIYKEMINQNCSPDLQLLNTYMDCMFKAGEPEKGRAMFAEIKSH
RFVPDARSYSILIHGLIKAGFANETYELFYSMKEQGCVLDTRAYNIVIDGFCKCGKVNKAYQLLEEMKTKGFEPTVVTYG
SVIDGLAKIDRLDEAYMLFEEAKSKRIELNVVIYSSLIDGFGKVGRIDEAYLILEELMQKGLTPNVYTWNSLLDALVKAE
EINEALVCFQSMKELKCTPNQVTYGILINGLCKVRKFNKAFVFWQEMQKQGMKPSTISYTTMISGLAKAGNIAEAGALFD
RFKANGGVPDSACYNAMIEGLSSGNRATDAFSLFEETRRKGLQIHTKTCVVLLDTLHKNDCLEQAAIVGAVLRETGKARH
AARSW*

DNA
ATGCGGATGCTACTAAGACCAGGAATTATATTTCACACCTATACACAATCCTCTTGTGCTGTCACAGTTTGTAAGCCCTT
ATCATCTTTGTCTGATAATGGCGAAAATCATGAGAAACCATATACATTTGAGGGTAATATGCAAATTGTTAATGAAATTT
GTAATGTTTTGGAGACGAGTCCATGGGGACCTTCGGCTGAGACTGCTCTATCTGCTTTAAGCTTTAAACCACAACCAGAA
TTTGTCATTGGGGTTATACGGAGGCTGAAAGACGTTAATCGGGCGATTGAGTATTTCCGTTGGTATGAGAGAAGAACCGA
GCTGCCCCATTGTCCCGAATCATACAACTCCTTGCTTTTGTTGATGGCTCGTTGTAGAAATTTTGATGCTTTGGAACAGA
TTCTTGGAGAAATGAGTGTTGCAGGATTTGGCCCTTCTGTTAATACTTGTATTGAGATGGTTTTGAGCTGCGTTAAGGCT
AATAAGCTTAGGGAAGGTTTTGATGTTGTGCAGTTGATGAGAAAGTTCAAGTTCCGACCTGCTTTTTCAGCTTACACAAC
TCTTATCGGAGCTTTTTCGGCAATTAATCATTCTGATATGATGCTGACTCTCTTTCAGCAGATGCAGGAGTTAGGATATG
AACCAACTGTTCATCTTTTTACGACATTGATTCGGGGATTTGCCAAAGAGGGTAGAGTTGATTCTGCTCTATCTTTGCTT
GATGAGATGAAGAGCAGCTCTCTTGATGCCGACATTGTTCTTTACAACGTATGTATAGATAGCTTTGGTAAAGTGGGCAA
GGTTGATATGGCATGGAAATTTTTTCACGAGATTGAAGCTAATGGTTTAAAGCCTGATGAAGTCACTTATACTAGCATGA
TAGGAGTTCTGTGCAAGGCAAACAGATTGGATGAAGCTGTGGAGATGTTTGAGCATTTAGAGAAGAATAGACGGGTCCCT
TGCACTTATGCTTACAACACGATGATTATGGGTTACGGTTCGGCTGGAAAATTTGATGAAGCATACAGTCTCCTAGAGAG
ACAAAGGGCAAAGGGCTCTATACCGAGTGTGATCGCATATAATTGCATTCTTACATGTTTAAGGAAAATGGGAAAAGTGG
ACGAAGCTTTGAGAATGTTTGAGGAGATGAAAAAGGATGCTGCTGCAAATCTTTCAACGTATAATATTCTCATTGACATG
ATGTGTAGAACTGGTAAACTTGACTATGCTTTTAAGCTACGTGATTCTATGCAGAAGGTTGGTCTGTTTCCTAATGTTAG
GACTGTGAACATAATGGTTGATCGGCTCTGTAAATCCCAAAAACTTGATGAAGCATGTGCTATATTTGAGGAAATGGATT
ATAAGGTTTGTACCCCAGATGAGATTACATTTTGCTCCCTCATAGATGGCTTAGGGAAGGTCGGAAGAGTTGATGACGCT
TACAAAATATATGAGAAGATGTTGGATTCTGATTGTCGTACTAACTCTATTGTTTACACATCCCTGATAAGGAACTTCTT
CAACCACGGTAGAAAAGAAGATGGACACAAGATATACAAGGAGATGATTAATCAAAATTGCTCGCCTGATTTGCAGCTTC
TTAATACGTACATGGATTGCATGTTCAAGGCTGGAGAACCAGAAAAGGGAAGGGCGATGTTTGCTGAAATAAAATCCCAT
CGGTTTGTCCCAGATGCTCGAAGCTACTCGATATTAATTCATGGACTAATAAAAGCAGGGTTTGCAAATGAAACGTATGA
GTTGTTTTATTCCATGAAAGAGCAAGGCTGTGTCTTGGACACACGTGCTTACAATATTGTCATTGACGGTTTCTGCAAGT
GCGGAAAAGTTAACAAAGCTTATCAGCTGCTGGAGGAAATGAAGACAAAAGGTTTTGAGCCAACTGTCGTTACATATGGT
TCGGTCATTGACGGGCTTGCAAAAATAGATCGGCTTGATGAAGCTTATATGCTCTTTGAGGAAGCAAAATCAAAGAGAAT
AGAGCTAAACGTGGTAATCTACAGTAGTCTTATTGATGGGTTTGGGAAAGTTGGTAGGATAGATGAAGCTTACCTTATCC
TGGAAGAGCTTATGCAGAAAGGATTAACACCTAATGTTTATACATGGAACTCATTGCTTGATGCATTGGTCAAAGCTGAG
GAAATCAATGAAGCCCTTGTCTGTTTTCAGTCGATGAAAGAATTGAAATGCACGCCAAACCAAGTTACTTACGGTATACT
AATAAATGGTCTTTGTAAGGTCAGGAAGTTCAATAAAGCCTTTGTCTTTTGGCAAGAGATGCAGAAACAGGGGATGAAAC
CCAGCACTATTTCTTACACCACCATGATATCTGGACTTGCAAAGGCTGGGAATATTGCAGAGGCTGGGGCGCTCTTTGAT
CGGTTTAAGGCAAATGGTGGCGTTCCAGACTCTGCTTGTTATAATGCCATGATCGAAGGTCTAAGTAGCGGAAACAGGGC
AACAGATGCTTTTTCTCTTTTTGAGGAAACACGTCGAAAAGGATTACAGATCCATACCAAGACCTGTGTTGTTCTTTTGG
ATACTTTGCATAAGAATGATTGTCTTGAGCAAGCAGCTATTGTTGGTGCTGTTTTGAGAGAAACAGGAAAGGCACGACAT
GCTGCACGATCTTGGTAG