Details for Capsella Locus Carubv10012946m

Position : scaf_3 ( 5`- 603193 .. 606832 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012946m

Protein [Map View]
MAAERSTITLGGKGSSFTCSSVYKIASGLASVRIDSSAIERFSTRNTPSVKRLSFGIPEGLTDRETRASLAVILNKLILS
TSAPPSSSTPRSFLPLKILDILNSNAESFDSGEIDLTEGENTVLEKSFASLIGLCSIIDHKSTSLSQIVDSVAALSCEVT
KADIASFSSLDSGDGNGDKDVIGVAGDLKVLLNGYKGTGKLEIEEISKIPWIHGKFRYAVKSLHSDARRELNSGVKGGKT
GSGNTGIGEALGTTLAPLLTAIKNLGVCSFLRSKLCFESIGNENLKNALSQVFENCCVENENLKSSYKLAYTAHVEEDYS
RFAHELNASLGIVWRIVGLEAVAAFFALAGGELFVQKRGDAEKEESKTDKKKKKNEKKTVVGKGTSLVIQFIKDRLVSNE
GASDVDLMNYLKQWVEQILNLFNPEGHGFDSFLEKVKEIVESNENRRLPKLPKGTRDFAKEQMAVREKAFSIIQNVFKRH
GATALDTPVFELRETLMGKYGEDSKLVYDIADQGGELCSLRYDLTVPFARYVAMNGITSFKRYQIAKVYRRDNPSKGRYR
EFYQCDFDIAGLFEPMGPDFEIVKILTELLDELEIGDYEVKLNHRKLLDGMLEICGVPPEKFRTICSSIDKLDKQSFEQV
KKEMVEEKGLSSEIADRIGNFVKEKGAPLELLSKLRQEGSEFLGNQSSREALDELSIMFEALERSKCSRRIVFDLSLARG
LDYYTGVIFEAVCIGAEVGSIGAGGRYDNLIGMFGTKQVPAVGMSLGIERVFNIMEELNEKKNQVIRPTETQVLVSIMKD
NKLAEAAELVSQLWEAKINAEYLVSKRKSKHFDRAKESGIPWMVMVDEAELSKGVVTLKKLVKGSEKEIKDVSKDSFVGE
LLKELS*

DNA
ATGGCAGCGGAGAGATCTACCATCACTCTCGGAGGGAAAGGATCGTCTTTCACTTGTTCCTCCGTTTACAAGATTGCTTC
TGGCCTCGCTAGTGTACGAATCGACTCTTCTGCGATCGAGAGATTCTCCACTAGAAACACTCCATCGGTTAAACGGCTCT
CCTTTGGTATCCCTGAAGGCTTAACGGACCGAGAAACCCGAGCTTCTTTGGCTGTAATCTTAAACAAGCTCATTTTGTCG
ACTTCTGCTCCTCCTTCTTCCTCCACCCCTCGTTCTTTTCTCCCACTTAAGATTTTGGACATTTTGAATTCCAATGCTGA
GAGTTTCGATTCCGGTGAGATTGATTTGACAGAAGGGGAAAACACTGTGTTGGAGAAGTCTTTTGCTTCGTTGATTGGAC
TCTGTTCTATTATAGATCACAAATCAACTTCTCTTTCCCAGATTGTGGATTCTGTTGCTGCGTTGAGTTGTGAGGTTACA
AAGGCTGATATAGCTTCGTTTAGCTCGTTGGATTCTGGGGATGGGAATGGTGATAAAGATGTGATTGGTGTTGCTGGTGA
TCTCAAGGTTTTGCTTAACGGGTACAAAGGTACAGGCAAATTAGAAATCGAAGAGATTTCGAAAATTCCTTGGATTCACG
GGAAATTCAGGTATGCGGTGAAAAGCTTGCACTCTGATGCTCGGAGAGAATTGAATTCCGGTGTTAAAGGAGGCAAAACT
GGATCTGGAAACACTGGAATTGGTGAGGCTTTAGGAACAACATTGGCACCTTTGTTGACAGCCATTAAAAACTTAGGAGT
ATGTTCGTTCCTTCGTTCTAAGCTCTGTTTTGAGTCTATTGGGAATGAGAATCTGAAGAATGCTTTGTCTCAAGTCTTCG
AGAACTGCTGTGTTGAGAATGAAAATCTAAAGAGTAGCTATAAGTTAGCTTATACTGCTCATGTGGAAGAGGATTACAGC
AGGTTTGCTCATGAACTGAATGCGTCTCTGGGAATCGTATGGAGAATTGTTGGTTTGGAAGCAGTTGCTGCCTTCTTTGC
TCTTGCAGGTGGAGAATTGTTTGTTCAGAAGAGGGGAGATGCGGAAAAGGAAGAGTCGAAGACCGATAAGAAAAAGAAGA
AGAATGAGAAAAAAACAGTTGTGGGGAAGGGGACGAGTCTAGTTATCCAGTTTATCAAAGATAGATTGGTGAGTAACGAG
GGAGCAAGTGATGTTGACCTGATGAATTATTTGAAGCAGTGGGTGGAACAAATCTTAAATCTTTTCAACCCTGAGGGTCA
CGGTTTTGATAGCTTCTTGGAGAAAGTGAAAGAGATTGTAGAAAGTAATGAAAACAGGAGACTTCCCAAGCTTCCAAAGG
GAACTCGAGATTTCGCTAAAGAACAAATGGCAGTCCGAGAAAAAGCATTTTCAATTATACAAAACGTTTTCAAGAGGCAT
GGTGCTACTGCACTTGATACTCCGGTTTTTGAATTGAGAGAGACCCTTATGGGGAAGTATGGAGAAGACTCGAAATTGGT
TTATGATATTGCTGATCAGGGTGGAGAGCTCTGCTCTTTACGGTATGATTTAACTGTTCCATTTGCACGGTATGTCGCTA
TGAATGGAATCACATCATTCAAAAGATACCAGATAGCAAAGGTATACAGAAGGGATAATCCATCGAAAGGGAGATACAGA
GAGTTTTATCAGTGTGATTTTGATATCGCTGGTTTGTTTGAACCAATGGGACCTGATTTTGAAATTGTCAAGATATTAAC
TGAACTTCTCGATGAATTGGAGATTGGAGATTATGAGGTGAAACTGAATCACCGCAAGTTGCTTGATGGAATGCTGGAGA
TATGTGGAGTACCTCCTGAGAAATTCAGAACCATCTGTTCAAGTATCGACAAGTTAGACAAGCAATCATTTGAGCAAGTG
AAGAAAGAAATGGTGGAGGAGAAGGGCTTGTCTTCAGAGATTGCAGACAGAATTGGCAACTTTGTTAAGGAGAAGGGAGC
TCCTTTGGAGCTATTGTCTAAACTGAGACAAGAAGGGAGTGAGTTCTTAGGGAACCAGTCATCAAGAGAAGCTCTTGATG
AGTTGAGTATCATGTTTGAAGCTCTTGAAAGATCAAAGTGCAGTCGCAGAATAGTGTTTGATCTAAGTCTAGCAAGAGGT
CTTGATTACTACACTGGCGTCATCTTTGAAGCCGTTTGTATAGGAGCAGAGGTTGGATCAATTGGTGCTGGTGGGCGATA
CGATAACCTAATAGGAATGTTTGGAACAAAGCAAGTCCCAGCGGTTGGGATGAGCCTTGGAATCGAGCGAGTGTTTAACA
TAATGGAAGAACTAAACGAGAAAAAGAATCAAGTGATACGACCTACGGAGACACAGGTATTGGTTAGTATAATGAAGGAT
AATAAACTAGCGGAAGCAGCGGAGTTGGTAAGTCAGTTATGGGAGGCTAAGATCAACGCAGAGTATCTTGTGAGCAAGAG
GAAGTCGAAGCATTTTGATCGCGCCAAAGAATCTGGAATTCCTTGGATGGTGATGGTAGACGAAGCGGAACTCAGTAAAG
GTGTTGTGACATTGAAGAAGTTAGTGAAGGGAAGTGAAAAGGAAATTAAGGACGTTTCTAAAGATAGTTTCGTTGGGGAA
TTGTTGAAAGAACTCAGTTGA