Details for Capsella Locus Carubv10012943m

Position : scaf_3 ( 5`- 1681393 .. 1685685 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012943m

Protein [Map View]
MGKRNTFWARNSNTRVRSKDKGSDESDEDYVISEEDEEESEADLKEEYASSLDGEPSFDGFGGSDALEDEEFDELEEEDV
MLRNVEWPKVKTGPRGNRKITGCKSRNTNQVLSDNEDVDLDDADDDEEDIRNSMQAVGKVGSLDGEKHQRIGLGKRRRVF
YEIEDEDGDYPEEDGEEDEERDVQNVRCENVDLNSLHDAEDGKMALEEQDNVSHETEKEDDGDYEDEDGDEDFTDEDVSL
DEEEEEETIACNKTSLKVGKKYKQKRRSGLGRKRRKKCSVAKAPLTRGRKRRGKNTKKGVDEDEDDGDGDFVDDSLPARK
KARTKSSRSRRRSTVPSDSDIASSGESDYEYTISEEEREQIREAGSLLRSSVKHASSIRQTTVKKDLPQLRKSPVKKGEK
KVELVKRDVIKNVCGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTPGVDLREVVIP
VPERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDLCDSSAHTYCVGLGREVPEGNWYCEGCRPVALGSASS
QTHITSEQQRVSGFYSRPSPPVVSGQYQDMSLLVTPRTPFFNGENLFSPRLPNGDVHGSSPSGLGATTLSRRRTLHRHIQ
NIINSDRLINMGARTGGTSIANSSDGFMTTQIGHSQTIDLSQPAVSQETGASLYTISEERLPNNNSLISAHDPELLSPKL
DEFGSQGVFRRLSNDTFLGERPIDLGFDHGLAQGDPLFSNQQHLHSYMPNTMSSMGGERLQQRVKAHLKNLSSKIDLGQT
TFDEISTCSIHTILAACELEHKSSEVHLVPPPVTCTHHHMTPGSSSRSSNSSSLMKGCCYSCFDSFVEDVVKMILDTRQP
HWLSLGLH*

DNA
ATGGGAAAGAGAAACACGTTCTGGGCTAGAAATTCGAATACAAGGGTTAGATCTAAGGATAAGGGTTCTGATGAATCAGA
TGAGGATTATGTGATTTCGGAAGAGGATGAAGAAGAATCTGAGGCTGACCTCAAGGAGGAGTATGCCTCATCTCTAGACG
GTGAACCATCCTTTGATGGTTTTGGTGGGTCTGATGCCCTGGAGGATGAGGAATTTGATGAGCTGGAAGAGGAAGATGTG
ATGCTGAGGAATGTTGAGTGGCCAAAAGTCAAAACTGGTCCTCGCGGGAATCGGAAAATCACTGGATGTAAGTCCAGAAA
CACCAACCAGGTTCTATCTGACAATGAAGATGTAGATCTCGACGATGCAGATGATGACGAGGAGGACATCAGGAATTCTA
TGCAGGCTGTTGGAAAAGTTGGGTCTTTGGATGGAGAGAAACACCAACGAATAGGTTTAGGAAAGCGAAGGAGAGTTTTC
TATGAGATTGAGGATGAAGATGGAGACTATCCAGAGGAGGATGGCGAGGAAGACGAAGAGAGGGATGTGCAAAATGTCAG
GTGTGAAAATGTGGATTTAAATTCTTTGCATGATGCTGAAGATGGAAAGATGGCATTGGAAGAGCAGGACAATGTGTCAC
ACGAGACAGAAAAGGAAGATGATGGAGATTATGAGGATGAGGATGGCGATGAAGATTTTACAGATGAAGATGTATCATTA
GACGAGGAAGAGGAGGAAGAAACAATTGCATGTAACAAAACCTCACTCAAGGTTGGTAAGAAATACAAGCAAAAGCGAAG
ATCTGGATTAGGGCGTAAAAGAAGAAAGAAATGCTCTGTTGCTAAAGCCCCTTTAACAAGGGGAAGAAAGAGACGTGGGA
AAAACACAAAGAAAGGAGTTGATGAAGATGAAGATGATGGTGATGGTGATTTTGTAGATGACTCTCTACCTGCAAGAAAA
AAGGCAAGGACAAAATCATCAAGGTCAAGGCGTCGCTCTACCGTGCCATCAGATTCAGACATTGCATCCTCTGGAGAATC
TGATTATGAGTACACAATCTCGGAGGAGGAAAGAGAGCAGATAAGAGAGGCCGGTAGTTTGTTGAGAAGTAGTGTGAAGC
ATGCATCATCTATAAGACAAACCACAGTCAAGAAGGATTTACCTCAGCTTCGTAAGTCTCCTGTGAAGAAAGGTGAAAAG
AAAGTAGAGCTTGTTAAAAGAGATGTGATAAAAAACGTTTGTGGGATTTGTCTGTCTGAGGAAGACATGCGAAGATTGAA
GGGAACATTGGACTGCTGTAGCCACTACTTTTGCTTCACTTGCATAATGGAGTGGTCGAAAGTAGAATCTCGCTGCCCAC
TCTGCAAACAGCGGTTCAGAACAATCAGTAAGCCTGCAAGATCTACACCTGGAGTAGATTTGAGAGAAGTTGTGATACCT
GTACCTGAACGTGATCAGGTCTATCAACCTACTGAAGAAGAGTTGAGGAGTTATCTCGATCCCTATGAAAATATAATATG
CACGGAATGTCACCAAGGTGATGATGATGGGCTTATGTTGCTTTGTGATCTTTGTGATTCATCTGCCCATACCTACTGTG
TTGGTCTTGGGAGGGAAGTACCTGAAGGAAACTGGTACTGTGAAGGTTGTAGACCTGTTGCACTTGGATCAGCTAGTTCC
CAAACGCATATTACATCCGAGCAACAAAGGGTTAGTGGCTTTTACAGTAGACCGTCACCTCCTGTAGTTTCAGGGCAATA
TCAAGATATGTCTTTGCTAGTCACTCCACGGACACCATTTTTCAATGGAGAAAACTTATTTTCTCCCAGGCTTCCCAATG
GTGATGTTCATGGTTCTTCTCCATCCGGCTTAGGGGCAACCACATTATCAAGAAGAAGAACGCTTCACAGACACATACAA
AATATTATCAACAGTGATAGACTTATTAATATGGGTGCTAGAACTGGTGGAACATCGATTGCTAACTCGAGTGATGGTTT
CATGACTACACAAATAGGTCATAGCCAAACAATTGACCTGTCTCAGCCTGCAGTGAGCCAAGAAACAGGGGCGTCATTGT
ATACAATATCTGAGGAAAGACTACCCAACAACAATTCATTGATTTCTGCCCATGACCCTGAGCTTTTGTCTCCAAAGTTA
GATGAATTTGGAAGCCAAGGAGTATTCAGACGTTTGTCTAATGATACATTTCTTGGCGAGCGACCTATCGATTTAGGATT
CGATCATGGACTGGCTCAGGGTGATCCCTTGTTTAGTAATCAACAACATCTACACAGCTACATGCCAAATACAATGTCTT
CCATGGGAGGAGAACGACTGCAACAAAGAGTTAAAGCCCATCTCAAAAACTTGTCCAGTAAAATCGACTTAGGTCAAACT
ACGTTCGACGAGATTTCCACGTGCTCAATACACACGATACTGGCAGCTTGTGAACTTGAACACAAGAGCAGTGAAGTCCA
TCTCGTCCCGCCACCAGTGACGTGTACTCACCATCATATGACACCTGGCAGCAGCAGCAGGAGTAGTAACAGCAGTAGCC
TGATGAAAGGGTGTTGCTATTCTTGTTTTGATTCATTTGTAGAAGATGTAGTTAAGATGATTCTAGACACAAGACAACCC
CATTGGTTGAGTCTAGGGCTCCATTAA