Details for Capsella Locus Carubv10012929m

Position : scaf_3 ( 5`- 1143505 .. 1147860 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012929m

Protein [Map View]
MSLFFLSPQFPSNSIHPIPRRAAGLSSIRCSISAPEKKPRRRRKQKRGDAADNDDSSSFGSGEAVSALERSLRLTFMDEL
MERARNRDSSGVSEVIYDMIAAGLAPGPRSFHGLVVAHALNGDEQGAMHSLRKELGAGQRPLPETMIALVRLSGSKGNAT
RGLEILAAMEKLNYDIRQAWLILVEELMRTNHLEDANKVFLKGARGGMRATDQLYDLMIEEDCKAGDHSNALDISYEMEA
AGRMATTFHFNCLLSVQATCGIPEVAYSTFENMEYGEDFMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKRV
QPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTIVLYNAGKFEDPLSLYLRALCREGRIVELIDALDAMRKDNQPI
PPRAMIMSRKYRTLVSSWIEPLQEEAELGYEIDYLARYIEEGGLTGDRKRWVPRKGKTPLDPDASGFIYSNPIETSFKQR
CLEDWKIHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIRGPAQNLLKPKAASKMVVSELKEELEAQGLPIDGTRN
VLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDELICRIKLHEGDTEFWKRRFLGEGLIETSVESSETAETVATGE
SEITIKDAAKEADDDEDDDEEEEQEGDEDDDENEEEEVVVAETENRAEGEDLVKNKAAEAKKHLQMIGVQLLKESDEANR
TKKRGKRASRMTLEDDADEDWFPEDPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDFKNKTPRKWSQEWEVELAMVLM
TKVIELGGIPTIGDCAVILRAAVRAPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDLGELDAAIAIVADMETTGITV
PDQTIDKVISARQSNENPRSEPEEPPSTGSS*

DNA
ATGTCTCTCTTCTTCCTCAGTCCTCAATTTCCCTCCAACTCAATCCACCCAATTCCTCGTCGCGCCGCCGGTTTATCCTC
CATTCGGTGCTCAATCTCTGCACCGGAGAAGAAGCCCAGGAGGAGGAGGAAGCAGAAGCGCGGCGACGCAGCAGATAATG
ACGACTCCTCGTCTTTCGGAAGCGGTGAAGCTGTCTCAGCCCTGGAGAGGAGTCTCCGCCTCACTTTCATGGACGAGCTT
ATGGAACGAGCTAGAAATCGAGACTCTTCTGGTGTATCCGAGGTTATCTATGACATGATTGCCGCTGGGCTTGCCCCTGG
ACCTCGTTCTTTCCATGGCTTGGTCGTAGCTCACGCTCTTAACGGCGACGAACAAGGCGCGATGCACTCGCTGAGAAAGG
AGCTAGGTGCAGGCCAACGCCCGCTTCCTGAAACAATGATTGCTTTGGTTCGACTCTCTGGTTCAAAAGGAAACGCTACG
AGAGGATTAGAAATCCTTGCCGCTATGGAAAAGCTTAACTATGACATTCGTCAAGCTTGGCTCATTCTTGTTGAGGAGCT
CATGAGAACCAATCACTTGGAAGATGCAAATAAAGTTTTCTTGAAGGGTGCTAGAGGTGGGATGAGAGCAACAGATCAGC
TTTATGATCTGATGATTGAAGAAGATTGCAAAGCTGGAGATCATTCTAATGCCTTAGACATCTCTTACGAAATGGAGGCA
GCTGGTAGAATGGCGACAACATTTCATTTCAACTGTCTTCTTAGTGTGCAGGCTACATGTGGGATTCCCGAGGTAGCTTA
TTCGACTTTTGAAAATATGGAGTATGGTGAAGATTTTATGAAACCTGACACTGAGACATATAACTGGGTGATTCAAGCCT
ATACAAGAGCTGAGTCATATGATAGGGTTCAGGATGTTGCTGAATTACTTGGAATGATGGTTGAGGACCACAAGCGTGTG
CAGCCAAACGTGAAGACTTATGCGCTCTTAGTTGAGTGCTTTACGAAATATTGCGTTGTGAAGGAAGCTATTAGACATTT
TCGTGCTCTGAAAAACTTTGAAGGAGGAACAATAGTTTTATACAACGCTGGGAAATTTGAGGATCCTCTCTCGTTGTATC
TCCGGGCTTTGTGTCGAGAAGGAAGAATTGTTGAGCTTATAGATGCTTTAGATGCAATGCGCAAAGATAACCAACCTATA
CCTCCAAGAGCCATGATTATGAGCAGAAAATATCGAACACTAGTCAGCTCATGGATTGAACCATTGCAAGAAGAAGCTGA
ACTTGGCTATGAGATTGATTATTTAGCAAGGTACATCGAGGAAGGGGGGCTTACTGGTGACCGCAAGCGTTGGGTACCTC
GAAAAGGGAAAACTCCTTTAGATCCCGATGCTTCTGGGTTTATATACTCAAACCCTATTGAAACATCCTTTAAACAGAGA
TGCCTTGAAGATTGGAAAATTCACCATAGGAAGCTGTTAAGAACCTTACAGAGTGAAGGTCTTCCAGTTCTAGGAGATGC
ATCCGAATCTGATTACATGAGAGTGATGGAGAGATTACGAAACATAATTAGAGGTCCTGCACAGAATCTTTTGAAGCCGA
AGGCAGCAAGCAAGATGGTTGTATCAGAGTTAAAGGAAGAACTTGAAGCTCAGGGTTTGCCAATTGATGGAACCAGGAAT
GTTCTTTACCAGCGAGTCCAAAAAGCAAGGAGAATAAACAAATCTCGAGGTCGACCTCTTTGGGTTCCTCCAATTGAAGA
AGAAGAGGAGGAGGTTGATGAAGAAGTAGACGAATTAATATGCCGAATCAAGCTACACGAAGGAGACACAGAGTTCTGGA
AACGTCGGTTTCTTGGAGAAGGCTTGATTGAAACGTCAGTTGAATCCAGCGAAACAGCTGAAACAGTAGCTACAGGTGAG
TCGGAGATCACAATTAAAGATGCTGCAAAAGAAGCTGATGATGATGAGGATGATGATGAGGAGGAAGAACAGGAAGGGGA
TGAGGATGATGATGAAAATGAAGAGGAAGAAGTGGTAGTTGCAGAAACTGAGAATCGAGCAGAAGGAGAGGATTTAGTTA
AGAATAAGGCAGCTGAAGCTAAGAAGCATCTTCAAATGATTGGAGTTCAACTCTTGAAAGAATCTGATGAAGCAAACAGA
ACAAAGAAACGTGGGAAGAGGGCATCTCGTATGACACTTGAGGATGATGCAGATGAGGATTGGTTCCCTGAAGACCCATT
TGAAGCATTCAAAGAAATGAGGGAAAGGAAAGTATTTGACGTGTCTGACATGTATACAATAGCAGATGTTTGGGGTTGGA
CATGGGAGAAGGATTTTAAGAACAAAACTCCGAGGAAATGGTCACAAGAGTGGGAAGTCGAGTTGGCAATGGTACTCATG
ACAAAGGTGATTGAATTGGGTGGAATTCCAACGATTGGCGATTGTGCGGTGATATTGCGAGCTGCTGTAAGAGCTCCCAT
GCCTTCAGCCTTCTTGAAGATCTTGCAGACGACACACAGTCTTGGCTACTCTTTTGGCAGCCCGTTGTACGATGAGATTA
TCACATTGTGTTTGGACCTTGGAGAACTTGATGCAGCCATTGCCATAGTGGCAGATATGGAAACCACAGGGATCACTGTC
CCTGATCAAACCATTGACAAGGTCATATCTGCTAGACAATCAAATGAGAATCCCCGGTCTGAGCCTGAAGAACCACCATC
AACAGGAAGCTCTTAG