Details for Capsella Locus Carubv10012928m

Position : scaf_3 ( 5`- 3720001 .. 3725870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012928m

Protein [Map View]
MVGLEDNAEKERSPVVENGFSNGSRSSPSTDVLSPSQKAIQGNDTLSYANILRARNKFADALALYETMLEKDSKNVEAHI
GKGICLQTQNKGNLAFDCFSEAIRLDPHNACALTHCGILHKEEGRLVEAAESYQKALMADASYKPAAECLAIVLTDLGTS
LKLAGNTQEGIQKYYEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKAALERPMYAEAYCNMGVIYKNRGDLEMAIT
CYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDVTQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELA
FNFNPHCAEACNNLGVLYKDRDNLDKAVECYQMALSIKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFN
NLGVLYRDAGNITMAIDAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDNLKDPER
PITIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKVLKKGGVWKDIYGIDEKKIASMVREDK
IDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNTTGLPTVDYRITDSLADPLDTKQKQVEELVRLPESFLCYTPSPEA
GPVCPTPALSNGFVTFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKRVDLLPL
ILFNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLGHLVAKSEEEYVQLSVDLA
SDVTALSKLRMSLRDLMAGSPVCNGPSFAVALESAYRNMWKKYCKGEVPSLRRMEMLQKEVQDDPLISKDLGASKLSFTG
EATPSLKANGSAPVPSSLPTQSPHLSKRMDSTS*

DNA
ATGGTTGGGCTGGAAGATAATGCTGAGAAAGAGCGGTCACCAGTCGTAGAGAATGGTTTCTCCAATGGATCTCGATCATC
TCCTAGCACAGATGTTTTGTCCCCATCACAAAAGGCCATTCAGGGGAATGACACGCTTTCTTATGCCAATATTCTTCGGG
CAAGAAACAAGTTTGCTGATGCGCTTGCTCTCTATGAGACTATGCTGGAGAAAGATAGCAAGAATGTTGAAGCTCACATT
GGGAAAGGGATATGCTTGCAGACGCAAAACAAAGGGAATCTAGCTTTCGATTGTTTTTCTGAAGCGATCAGGTTGGATCC
GCATAATGCTTGTGCCCTCACGCACTGTGGTATACTTCATAAAGAAGAGGGTCGCCTCGTAGAAGCTGCTGAGTCTTACC
AGAAAGCACTGATGGCAGATGCATCATACAAGCCAGCTGCGGAGTGCTTAGCAATTGTTTTGACTGACCTTGGAACGAGT
CTGAAGCTGGCTGGGAATACTCAGGAGGGAATTCAAAAGTATTACGAAGCCCTTAAGATTGATCCGCACTATGCTCCTGC
ATATTATAACTTAGGTGTTGTATACTCTGAAATGATGCAATACGACAATGCCTTGAGCTGCTACGAGAAGGCTGCACTTG
AGAGGCCTATGTATGCTGAAGCATATTGTAACATGGGTGTCATTTATAAGAACCGTGGTGACTTGGAGATGGCAATCACT
TGTTATGAGAGATGTCTAGCTGTGTCTCCAAACTTTGAGATTGCGAAGAACAATATGGCCATAGCTCTGACAGATCTAGG
AACAAAGGTTAAACTTGAAGGCGATGTGACCCAAGGAGTGGCATATTACAAGAAGGCTCTCTATTATAACTGGCACTATG
CAGATGCTATGTATAATCTTGGGGTGGCTTACGGTGAAATGCTGAAGTTTGACATGGCAATTGTCTTCTATGAGCTTGCT
TTCAACTTCAATCCACATTGTGCTGAGGCTTGCAACAATTTGGGGGTACTTTACAAAGACCGCGACAACCTTGATAAAGC
TGTAGAGTGTTATCAGATGGCTCTATCAATCAAACCGAATTTCGCGCAGTCGCTTAATAACCTTGGTGTCGTCTACACAG
TCCAGGGGAAAATGGATGCTGCTGCCAGCATGATTGAGAAGGCCATCCTCGCTAATCCAACATATGCTGAAGCTTTTAAC
AACTTAGGTGTTCTTTACAGAGATGCTGGAAATATCACTATGGCTATTGATGCTTATGAGGAATGCCTTAAAATAGATCC
AGATTCCCGCAATGCTGGCCAGAACCGATTGCTTGCCATGAACTACATAAATGAAGGACTCGATGACAAACTATTTGAGG
CTCACAGAGACTGGGGTTGGCGCTTCACAAGATTACACCCTCAGTACACTTCATGGGACAATCTGAAAGATCCAGAGCGA
CCTATCACCATTGGATATATCTCACCAGATTTCTTCACTCATTCAGTATCTTATTTCATTGAAGCCCCCCTTACGCATCA
TGATTATACAAAGTACAAAGTGGTGGTTTATTCAGCGGTAGTTAAGGCAGATGCAAAAACATATAGGTTTAGGGATAAAG
TGTTGAAGAAAGGGGGAGTTTGGAAAGATATATACGGGATAGATGAGAAAAAAATAGCAAGTATGGTCAGAGAAGACAAA
ATCGACATTTTGGTAGAACTCACAGGTCATACGGCAAACAACAAGTTGGGAACAATGGCCTGTAGACCAGCACCTGTTCA
GGTTACTTGGATAGGCTATCCAAATACTACGGGTTTGCCCACTGTTGATTACAGAATCACGGATTCGTTGGCTGACCCAC
TAGACACCAAACAAAAGCAGGTGGAGGAGCTGGTTAGGCTTCCAGAGTCTTTTCTTTGTTATACGCCTTCCCCAGAGGCT
GGTCCTGTTTGTCCAACACCTGCGCTTTCCAATGGCTTTGTCACATTTGGTAGTTTCAACAATCTCGCAAAGATCACTCC
GAAGGTGCTGCAAGTGTGGGCTAGGATACTGTGTGCAGTTCCCAATTCTCGCCTAGTGGTAAAATGCAAACCCTTCTGCT
GTGATAGTATTAGGCAGAGGTTTCTCACGACGCTGGAGCAGCTTGGGTTAGAATCAAAGCGTGTTGATCTCTTGCCTTTG
ATTCTTTTCAATCACGACCATATGCAAGCTTATTCCTTAATGGATATTAGTTTGGACACATTCCCATATGCCGGTACTAC
CACTACCTGTGAATCTCTCTACATGGGAGTTCCATGCGTTACAATGGCTGGCTCGGTACATGCTCATAATGTTGGTGTCA
GTCTTCTCACTAAAGTTGGATTAGGACACCTGGTTGCCAAAAGCGAGGAAGAGTATGTTCAATTATCTGTTGATCTAGCC
TCTGATGTCACAGCTCTTTCTAAATTGAGAATGAGTCTCCGGGATCTAATGGCTGGATCCCCTGTTTGTAATGGTCCCTC
CTTTGCTGTTGCTCTTGAATCTGCATACCGGAATATGTGGAAAAAGTACTGCAAAGGTGAAGTACCGTCCTTAAGGCGAA
TGGAAATGCTGCAAAAAGAGGTCCAAGATGATCCCTTAATCTCAAAAGACTTAGGAGCATCAAAACTCAGCTTTACTGGA
GAAGCCACTCCTTCTCTCAAGGCCAATGGTTCTGCTCCTGTACCTTCCTCTTTACCAACCCAATCCCCGCACCTCTCAAA
GAGAATGGACTCCACTAGTTAG